KEGG   Salmo salar (Atlantic salmon): 106573759Help
Entry
106573759         CDS       T04363                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H1-like
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106573759
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106573759
Enzymes [BR:sasa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106573759
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106573759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 106573759
NCBI-ProteinID: XP_014004573
UniProt: A0A1S3MP13
LinkDB All DBs
Position
ssa16
AA seq 1040 aa AA seqDB search
MGESKNMVLNGRRHGSRYSSDLSITSARSLRQSKGSFRRRRCSRRVSSSALEAERRHTPS
SGMTAKELCENDDLTTSLILDPYLGFQTHKMNRRFRPVKDRHRHLKEVLECFKKHDNLEK
AFHALTAGDWSRHHFPHKTKAQGKLFKEHVFVYLRMFATNSGFEILPCNRYSSEQNGAKI
VATKDWKTNDKIEYLVGCIAELSQNEESVLLRHGENDFSVMYSTRKNCAQLWLGPAAFIN
HDCRPNCKFVSTGRDTACVKVLGDIEPGEEISCYYGDGFFGENNELCECYTCERRGAGAF
KSKTGQPTPTPIINSMYGLRETDKRLNRLKKLEDSKCSGSQLEGSNMDPDSQENHDTHPS
VGRTARSSVTRLSDAQALSRQTLSKMPIPTSSFNQRHSKNSNVPKRLKSKSIKPLLKLGR
RCQVTAHKCPIEVEAMGLCLKDPTEFVNNRVSQKREMDKKGPVQVVGTRGGLEHYTAKEN
HQKSVKDVSRCPDGLACTHRTRSSTRASVGTQESDNIKLEPNLPPIHCGVVSKTKPMDLG
DCVTDIHWMNSSSLDISCPKTENCPRHKQMIKQEEHSFRPASLLKEEVSCLHHTACTTDI
ADGRKELQGLPDGHEPYNLSKGDKLLHLGKVKKKQQITRYDSQLILANNNSGVPKLTLRR
RRDSSSSRIEPGEADPVKSSSPTKTSMKFGKDHHAKTKRSSYAARLSNGTFSPVDQIRSS
KHGLSPVDHIRSSKHGLSPVDHIRSSKHGLSPVDHIRSSKHGLSPVDHIRSSKHGLSPVD
HIRSSKHGLSPVDHIRSSKHGLSPVDHIRSSKHGLSPVDHIRSSNHGLSPVDHIRSSKHG
LSPVDHIRSSKHGLSPVDHIRSSKHGLSPVDHIRSSKHGLSPVDHIRSSKHGLSPVDHIR
SSKHGLSPVDHIRSSKHGLSPVDHICSSKLHIQLQHEQDSRRLSQYHHGTGPFTGIVERE
AGEVFGPTVATFGMHDDTEEDSSSSSEEDEDDVSDSDHEEFDDFIPLPPTKRLRLIVGKD
SIDIDIASRRRENQSRTVNA
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atgggggaatcaaagaacatggtgttgaatggcaggcggcatggcagcagatactccagt
gatctatccataacctcggccaggtcgctgcgacagagcaagggctcctttagaaggagg
agatgtagtcgacgtgtcagtagttctgccctagaggcagagaggcgtcataccccatca
tctggtatgactgcaaaggagctctgtgagaatgatgacttgactacaagccttattctg
gacccctacctcggcttccagacccataagatgaataggaggtttcgacccgtcaaggac
cgacatagacatttgaaggaggtgctagagtgctttaaaaaacatgacaaccttgagaag
gccttccatgccttgactgcaggggactggtcaagacaccactttccgcacaagacgaag
gcacagggcaaactcttcaaagagcatgtttttgtttacctacgaatgtttgcaactaac
agtgggtttgaaatacttccttgcaatcgttattcctctgagcagaatggagccaaaatt
gtagcaacaaaagactggaaaaccaatgataagatagaatacctggtgggctgcatcgct
gagctatcgcagaatgaggaaagtgtgttactgcgacatggagaaaatgacttcagtgtg
atgtactccacccgcaagaactgtgctcaactgtggctgggacctgcagccttcatcaac
catgattgcaggccaaattgcaagtttgtttccactgggcgagatacagcttgtgtcaag
gttcttggggatattgaacccggggaagagatctcctgttattatggagatggcttcttt
ggggaaaataatgaactatgtgaatgttacacatgtgaaagacgaggtgctggtgctttc
aaatcgaagactggacagcctacgcccactccaattatcaacagcatgtatggcctgaga
gagacagacaaacgtctcaatcggctgaagaaactagaagacagcaaatgctctggcagt
cagttggaaggctctaatatggatccagactctcaggaaaatcatgacacgcatccatca
gtagggaggacagcccgctctagtgtgacaaggctcagtgacgcacaagctctaagcagg
caaactctgtccaaaatgcctatccctacctcatcgttcaatcaaagacactcaaagaac
tccaacgtgccaaagaggctaaaatcaaagtccataaagcctttgctcaagttaggaaga
aggtgtcaggtaactgcccacaagtgccccattgaggtggaagctatgggtttgtgcctt
aaggaccccacagaatttgtcaataacagggtctcacaaaagagagagatggataagaaa
gggccggtgcaagtggtgggaacaagaggtggtcttgagcactatactgcgaaggaaaac
catcagaaatcagtgaaagatgttagtaggtgccctgatggtttagcttgcactcacaga
actcgcagttcaaccagagcatcagttggcacacaggagtctgacaacattaaacttgaa
ccaaacttgccacccatccactgcggtgtggttagtaagaccaagcctatggaccttgga
gattgtgtcacagacattcactggatgaacagctcaagcctggacatcagctgtccaaag
acggagaactgtcccagacataagcaaatgataaagcaggaagagcactctttccgacca
gcatcccttctcaaggaggaggtttcatgcctgcaccatacagcctgtaccacagacatt
gctgatggcaggaaagagctgcagggcctgcctgatggtcatgagccctacaacctgtct
aagggagacaagcttctccaccttggcaaggtgaagaagaaacagcagattacacgctat
gattcccagctgatcctagccaacaacaactcaggcgtccccaagttgaccctgcggaga
cgaagggacagcagcagcagtaggattgagcctggtgaggcagaccctgtcaagtcctcc
agccccacaaagaccagcatgaaatttggtaaggaccatcatgcaaagaccaagaggagc
tcttatgcagccagactgagtaatgggactttcagtcctgtggaccagatccgctcctcc
aaacatggcctcagtcctgtggaccacatccgttcctccaaacatggcctcagtcctgtg
gaccacatccgctcctccaaacatggcctcagtcctgtggaccacatccgctcctccaaa
catggcctcagtcctgtggaccacatccgctcctccaaacatggcctcagtcctgtggac
cacatccgctcctccaaacatggcctcagtcctgtggaccacatccgttcctccaaacat
ggcctcagtcctgtggaccacatccgctcctccaaacatggcctcagtcctgtggaccac
atccgctcctccaatcatggcctcagtcctgtggaccacatccgctcctccaaacatggc
ctcagtcctgtggaccacatccgctcctccaaacatggcctcagtcctgtggaccacatc
cgctcctccaaacatggcctcagtcctgtggaccacatccgctcctccaaacatggcctc
agtcctgtggaccacatccgctcctccaaacatggcctcagtcctgtggaccacatccgt
tcctccaaacatggcctcagtcctgtggaccacatccgctcctccaaacatggcctcagt
cctgtggaccacatttgctcctccaaactgcatattcagctgcagcatgagcaggacagc
aggaggctcagccagtatcaccatggtactgggcccttcacgggtatagtagagagggaa
gcaggggaggtctttgggccgactgtagcaacatttgggatgcatgatgacacagaggaa
gactcgtcctcctcctctgaagaggatgaagacgacgtctctgactctgaccatgaagag
ttcgacgatttcattccacttccaccaacaaaacgcctccgactcattgttggtaaagac
tctatagatattgatattgcatcaaggagacgtgaaaatcagtcacgcacagtcaatgca
tga

DBGET integrated database retrieval system