KEGG   Salmo salar (Atlantic salmon): 106574304
Entry
106574304         CDS       T04363                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta-like
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04110  Cell cycle
sasa04150  mTOR signaling pathway
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04510  Focal adhesion
sasa04910  Insulin signaling pathway
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106574304
   04310 Wnt signaling pathway
    106574304
   04340 Hedgehog signaling pathway
    106574304
   04150 mTOR signaling pathway
    106574304
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106574304
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106574304
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106574304
   04916 Melanogenesis
    106574304
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106574304
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106574304
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     106574304
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   106574304
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106574304
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo Choline_kinase
Other DBs
NCBI-GeneID: 106574304
NCBI-ProteinID: XP_014005589
UniProt: A0A1S3MR17
LinkDB
Position
ssa16
AA seq 430 aa
MSGRPRTTSFAESCKAVPQPSAFGSMKVSRDKDGSKMTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELIAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMVYVKMYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVSQQPCVIGSQVFRPRTPPEAIALCSRLLEYTPTARFTPLEACAHTFFDELRDPNLK
LPNGREKPLLFNFSTQELSSNPSLASILIPAHARNQPGAFTPTNASAPSDANSGDRGHTT
NAASASNAST
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgtcgggtcggcccagaaccacctcctttgcggagagctgcaaggcagtgccgcagccc
tcagcatttggcagtatgaaagtcagcagagacaaagatggcagtaagatgaccacagtg
gtagcgaccccaggccagggccccgaccggccgcaggaggtcagctatacagacactaag
gtcatcggcaacggctcgttcggcgtggtctaccaggctaaactgtgtgactccggggag
ctaatagccatcaagaaggttctgcaggacaagaggttcaagaaccgggagctgcagatc
atgaggaaactggaccactgcaacatagtgcgtttgcgctacttcttctattccagtgga
gacaagaaggacgaggtgtatctcaacctggttttggactacgttcctgagactgtgtac
agagtggctagacactacagccgagccaaacagaccctccccatggtctatgtgaagatg
tacatgtaccagctcttccggagcttggcctacatccattcctttgggatctgccatcgg
gacatcaagcctcagaacctgctgttggacccggagacagccgtgctcaagctctgtgac
tttggcagtgcgaagcagctggtccgtggtgagcccaatgtgtcctacatctgctcacgg
tactacagagcccccgagctcatctttggggccactgactacacctccagcatagatgta
tggtccgctggctgcgttctagcagaactgttgctagggcaacccatttttcccggcgac
agtggggtggatcagttggtggagatcatcaaggttctcggcactcccactcgggagcag
atcagagagatgaatcccaactacactgagtttaagttccctcagatcaaggcacaccca
tggactaaggtgagtcaacagccttgtgtgattggctctcaggtgttccggccgcgcaca
ccccctgaggccatcgctctgtgctcgcggctgctggagtacacgcccacagcgcgcttc
acgcccctggaggcctgtgcccacacctttttcgacgagctccgggaccccaacctcaag
ctgcccaacgggcgcgagaagcccctgctcttcaacttctccacacaggagttgtccagt
aacccctccctagcctccatcctcatccccgcccacgcccggaatcagcccggggccttc
acccctaccaacgcctccgcaccctcagatgccaacagcggagaccgtggccataccacc
aacgctgcctccgcctccaacgcctccacctga

KEGG   Salmo salar (Atlantic salmon): 106575154
Entry
106575154         CDS       T04363                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta-like
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04110  Cell cycle
sasa04150  mTOR signaling pathway
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04510  Focal adhesion
sasa04910  Insulin signaling pathway
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106575154
   04310 Wnt signaling pathway
    106575154
   04340 Hedgehog signaling pathway
    106575154
   04150 mTOR signaling pathway
    106575154
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106575154
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106575154
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106575154
   04916 Melanogenesis
    106575154
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106575154
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106575154
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     106575154
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   106575154
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106575154
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo Choline_kinase
Other DBs
NCBI-GeneID: 106575154
NCBI-ProteinID: XP_014006858
UniProt: A0A1S3MUF6
LinkDB
Position
ssa17
AA seq 362 aa
DKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELIAIKKVLQD
KRFKNRELQIMRKLDHCNIVRLRYFFYSSGDKKDEVYLNLVLDYVPETVYRVARHYSRAK
QTLPMVYVKMYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLVRG
EPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEII
KVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARFT
PLEACAHTFFDELRDPNLKLPNGREKPLLFNFSTQGMDGAHTQLCISYRITRMDKDPQTT
AI
NT seq 1091 nt   +upstreamnt  +downstreamnt
gagacaaagatggcagtaaggtgaccacagtggtagcgaccccaggccagggccccgacc
ggccgcaggaggtcagctatacagacactaaggtcatcggcaatggctcgttcggcgtgg
tctaccaagctaaattgtgtgactccggggagctaatagccatcaagaaggttctgcagg
acaagaggttcaagaaccgggagctgcagatcatgaggaaactggaccactgcaacatag
tgcgtttgcgctacttcttctattccagtggagacaagaaggacgaggtgtatctcaacc
tggttctggactacgttcctgagactgtgtacagagtggctagacactacagccgagcca
agcagaccctccccatggtctatgtgaagatgtacatgtaccagctcttccggagcttgg
cctacatccattcctttgggatctgccatcgggacatcaagccccagaacctgctgctgg
acccagagacagccgtgctcaagctctgtgactttggcagtgcaaagcagctggttcgtg
gtgagcccaatgtgtcctacatctgctcacggtactacagagcccccgagctcatctttg
gggccactgactacacctccagcatagatgtatggtccgctggctgcgttctagcagaac
tgttgctagggcaacccatttttcctggtgacagtggggtggatcagctggtggagatca
tcaaggttctcggcactcccactcgggagcagatcagagagatgaatcccaactacactg
agtttaagttccctcagatcaaggcacacccatggactaaggtgttccggccgcgcacgc
cccctgaggccatcgctctgtgctcgcggctgctggagtacacgcccacagcgcgcttca
cgcccctggaggcctgtgcccacacctttttcgacgagctccgggaccccaacctcaagc
tgcccaacgggcgcgagaagcccctgctcttcaacttctccacacagggtatggatggag
ctcatacacagctctgtatctcctacagaattactagaatggacaaagaccctcagacca
ctgcaatttga

KEGG   Salmo salar (Atlantic salmon): 106582120
Entry
106582120         CDS       T04363                                 

Gene name
gsk3b
Definition
(RefSeq) glycogen synthase kinase 3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04110  Cell cycle
sasa04150  mTOR signaling pathway
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04510  Focal adhesion
sasa04910  Insulin signaling pathway
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106582120 (gsk3b)
   04310 Wnt signaling pathway
    106582120 (gsk3b)
   04340 Hedgehog signaling pathway
    106582120 (gsk3b)
   04150 mTOR signaling pathway
    106582120 (gsk3b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106582120 (gsk3b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106582120 (gsk3b)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106582120 (gsk3b)
   04916 Melanogenesis
    106582120 (gsk3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106582120 (gsk3b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106582120 (gsk3b)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     106582120 (gsk3b)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   106582120 (gsk3b)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106582120 (gsk3b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo Choline_kinase
Other DBs
NCBI-GeneID: 106582120
NCBI-ProteinID: XP_014020348
UniProt: A0A1S3NY87
LinkDB
Position
ssa21
AA seq 421 aa
MSGRPRTTSFAESCKPVPQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELLAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMVYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHA
WTKVSQQVFRPRTPPEAIALCSRLLEYTPTSRFTPLEACAHSFFDELRDPNVNLPNGREK
PSLFNFTTQELSSNPSLANILIPAHACTQASTPTTATTDGNSTDRSPNTITASASASNST
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtctggtcggcccagaaccacctccttcgcagagagctgcaaaccagtgccgcagccc
tcggcttttggctctatgaaagtcagcagggacaaggatggcagtaaggtgacgacggtg
gtggccaccccaggccaagggcccgacaggccccaagaggtcagctatacagacaccaag
gtgatcgggaacggctccttcggagtggtctaccaggccaagctgtgtgactctggagaa
ctgctggcgatcaagaaggttctgcaggacaagcggtttaagaaccgcgagctgcagatc
atgaggaagctggaccactgcaacatcgttcgcctgcgctacttcttctactccagcgga
gacaagaaggatgaggtgtatctgaacctggtactggactatgttcctgagacggtctac
agagtggccagacactacagccgagccaaacagaccctacccatggtctatgtcaagtta
tatatgtaccagctgttcaggagtctggcctacatccactcgtttgggatctgccatcgg
gacatcaaaccccagaacctgctgctggaccccgagacggccgtgctcaaactctgtgac
tttggcagcgctaagcagctggtacgcggagagcccaacgtgtcctacatctgctctcgc
tactacagagcccccgagcttatctttggtgccaccgactacacctctagcatagatgtg
tggtcagctggttgtgtgctagcagagctgttgctagggcaaccaatcttccccggcgac
agtggagtggatcagctggtggaaatcatcaaggttctggggaccccaacacgggagcag
atccgagagatgaaccccaactacactgagttcaagttcccccagattaaggcacacgca
tggactaaggtgagtcaacaggtgttccggccccgtacgccgccggaggccatcgccctg
tgctctcggctgctggagtacacgcccacctcgcgcttcacccccctggaagcgtgtgca
cactctttcttcgacgagctgagggaccccaacgtcaatctgcccaacgggcgagaaaaa
ccctccctctttaacttcaccacccaggagctgtccagtaatccctcgctggccaacatc
ctaatccccgcccacgcctgcactcaggcctccaccccaaccaccgccaccacagatggt
aacagcacagatcgcagccctaacaccattactgcctcggcctccgcctccaactccacc
tcctga

KEGG   Salmo salar (Atlantic salmon): 106586650
Entry
106586650         CDS       T04363                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04110  Cell cycle
sasa04150  mTOR signaling pathway
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04510  Focal adhesion
sasa04910  Insulin signaling pathway
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106586650
   04310 Wnt signaling pathway
    106586650
   04340 Hedgehog signaling pathway
    106586650
   04150 mTOR signaling pathway
    106586650
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106586650
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106586650
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106586650
   04916 Melanogenesis
    106586650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106586650
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106586650
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     106586650
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   106586650
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106586650
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo Choline_kinase
Other DBs
NCBI-GeneID: 106586650
NCBI-ProteinID: XP_014029634
UniProt: A0A1S3PQV5
LinkDB
Position
ssa25
AA seq 427 aa
MSGRPRTTSFAESCKPVPQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELLAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPIVYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVSQQVFRPRTPPEAIALCSRLLEYTPTSRLTPLEACAHSFFDELRDPNVKLPNGREK
PSLFNFTTQELSSNPSLANILIPAHARSQVATSTPTNATATVTTDGNSTDRGPSTTTASA
SASNSTS
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgtcggggcggccccgaaccacctccttcgcggagagctgcaaaccagtgccgcagccc
tcggcttttggctctatgaaagtcagcagggacaaggatggcagtaaggtgacaacggtg
gtggccaccccaggccaagggcccgacaggccccaagaggtcagctatacagacaccaag
gtgattgggaacggctccttcggagtggtctaccaggccaagctgtgtgactctggagag
ctgctggccatcaagaaggttctgcaggacaagaggtttaagaaccgcgagctgcagatc
atgaggaaactggaccactgcaacattgtacgcctgcgctacttcttctactccagcgga
gacaagaaggatgaggtgtatctaaacctggttctggactatgttcctgagacagtctac
agagttgccagacactacagccgagccaaacagactctgcccatagtctatgtcaagtta
tatatgtaccagttgttcaggagtctggcctacatccactcgtttgggatctgccatcgg
gacatcaagcctcagaacctgctgctggaccccgagacggctgtgctcaaactctgtgac
ttcggcagtgctaagcagctggtacgtggagagcccaacgtgtcctatatctgctctcgc
tactacagagcccccgagctcatctttggtgccaccgactacacctccagcatagatgtg
tggtcagctggatgtgtgctagcagagctgttgctagggcaaccaatcttccctggcgac
agtggagttgatcagctggtggagatcatcaaggttctggggacccctacacgggagcag
atccgagagatgaaccccaactacactgagttcaaattcccccagattaaggcacaccca
tggactaaggtgagtcaacaggtgttcaggccgcgcacgcccccggaggccattgccctg
tgctctcggctgctggagtacacgcccacctcgcgcctcacccccctggaggcgtgtgca
cactccttcttcgacgagctgagggaccccaatgtcaagctgcccaacgggcgagaaaaa
ccctctctcttcaacttcaccacccaggagctgtccagtaatccctcgctggccaacatc
ctaatccccgcccacgcccgctctcaggtcgccacctccaccccaaccaacgccaccgcc
accgtcaccacagatggtaacagcacagatcgtggccccagcaccactaccgcctcagcc
tctgcctccaactccacctcctga

DBGET integrated database retrieval system