KEGG   Salmo salar (Atlantic salmon): 106574427
Entry
106574427         CDS       T04363                                 

Definition
(RefSeq) metalloreductase STEAP3-like
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    106574427
   04115 p53 signaling pathway
    106574427
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106574427
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     106574427
Membrane trafficking [BR:sasa04131]
 Exocytosis
  Others
   Others
    106574427
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct 2-Hacid_dh_C NAD_binding_2 IlvN Shikimate_DH TrkA_N PAC4 NAD_binding_10 DUF898
Other DBs
NCBI-GeneID: 106574427
NCBI-ProteinID: XP_014005784
UniProt: A0A1S3MRL4
LinkDB
Position
ssa16
AA seq 507 aa
MSARQKYTDVKKGAQDRMPQEEMKKPLILGGASPRHLKTSISDPSTPLVGIMGTGDFSRS
LATRLVASGYRVVVGSRNPKRCASLFPEEAEVTTQHQAATQADLVFVALFPEHYSTLAGL
REPLVGKTLVDVSNGTKINRDKQSYAEQLANIFPESSVVKAFNVISAWSLQTGPRDGSRQ
VLICSDSSRAKSAVLQICRSLGFIPVDMGRLSSAQEIENTPLYLFPSWRVPCLSTLCLFF
FFYAYNFLRDVVHPYATAGKSKFYKIPVEMVNVTLPSVALVTLALVYLPGLVAAFLQLSW
GTKYRRFPNWLDRWLQQRKQLGLCAFLCAALHAVYSLCLPMRRSARYNLLNTAFKQVKVG
QEDSWVEEEVWRMELYLSIGILALGLLSLLAISSLPTVGNSLNWREFSFVQSRLGYMALL
MATLHTLTYGWDRGLDPEQYRFYLPPTFLLVLALPLAVLLGRLALFLPCVALRLSRIRRG
WEKSRAIRFTLPEDERNGLSQEDISNV
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgagcgcaagacaaaaatacacagacgtcaagaaaggagctcaggacaggatgccccag
gaggagatgaagaagcctcttatacttggtggtgccagccccagacacctcaaaacctca
atttctgatccaagtacccccttggttggcatcatgggcacaggtgacttctcccgctcc
ttagccaccaggctggtagcctctgggtaccgggtggtggtgggcagccgcaaccccaag
cgctgtgcctccctctttcccgaggaggctgaggtgaccacccagcaccaggctgccacc
caggccgacctggtgttcgtggccctcttccccgagcactactccaccctggctgggctg
agggagccgctagtggggaagactctggtggatgttagtaatggtactaagatcaacagg
gataagcagtcctacgcggagcagctggccaatatcttcccagagagcagtgtggtgaag
gccttcaatgtgatctcggcctggagcctgcagacggggccaagggacggcagcagacag
gtgctgatttgcagtgacagtagtagggccaagagcgctgtactccagatctgccgcagt
cttggcttcatccctgttgacatgggccgcctctcctctgcccaggagatagagaacacc
cccctgtacctcttcccctcgtggcgcgtcccatgtctctccaccctctgcctcttcttc
ttcttctatgcctacaacttccttcgtgacgtcgtccacccgtacgccacggcagggaag
agcaaattctacaaaattccggtggagatggtaaatgtgacactcccctcggtggccttg
gtgaccctggctctggtctacctgcccggccttgtggctgccttcctgcagctgtcgtgg
ggcaccaagtacaggcgtttccccaactggttggatcgctggctgcagcagcggaagcag
ttgggcctctgtgccttcctctgcgcagcgctgcacgccgtctacagcctgtgtttgccc
atgcgcaggtctgctcgctacaatcttctcaacactgccttcaaacaggtgaaggtaggc
caggaagactcgtgggtagaggaggaggtgtggaggatggagctgtatctgtctataggc
atcctggccctgggcctgctctctctgctggctatctcctcactgcccaccgtgggcaac
tcgctcaactggagggagttcagcttcgtacagtccagactgggctacatggccctgttg
atggccaccctccacacgctgacctacggctgggaccggggcttggacccggagcagtat
cgcttctacctccctcccaccttcttgctggtgctggccctgccgctggctgtgctgctg
gggaggctggctctgttcctgccgtgcgtggctctccggctgagtcgtatcaggagaggt
tgggagaaaagccgagccatacggttcacactgcctgaggacgagcgtaacgggctttca
caggaggacatcagtaatgtttga

KEGG   Salmo salar (Atlantic salmon): 106575265
Entry
106575265         CDS       T04363                                 

Gene name
steap3
Definition
(RefSeq) STEAP3 metalloreductase
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    106575265 (steap3)
   04115 p53 signaling pathway
    106575265 (steap3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106575265 (steap3)
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     106575265 (steap3)
Membrane trafficking [BR:sasa04131]
 Exocytosis
  Others
   Others
    106575265 (steap3)
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct NAD_binding_2 2-Hacid_dh_C IlvN Shikimate_DH TrkA_N TMEM169
Other DBs
NCBI-GeneID: 106575265
NCBI-ProteinID: XP_014007156
UniProt: A0A1S3MWN8
LinkDB
Position
ssa17
AA seq 490 aa
MPQEEMEKPLILGGASPRHLKTSISDPGTPLVGILGTGDFSRSLATRLVASGYRVVVGSR
NPKRCASLFPGEVEVTTQHQAATQADLVFVALFPEHYSTLAGLKEPLMGKTLVDVSSGTK
IDSDKQSKAEQLANIFPESSVVKGFNVISAWSLQKGPRDGSRQVPICSDSSRAKSAVLQI
CRNLGFIPVDMGRLSSAQEIENTPLYLFPLWRVPCLSTLGLFLLFYAYNFLRDVVHPYAM
AGKSTFYKIPVEVVNVTLPSVALVTLALVYLPGLVAAFLQLSWGTKYRRFPNWLDRWLQQ
RKQFGLCAFLCAALHAVYSLCLPMRRSARYSLLNAAFKQVKVGQEDSWVEEEVWRMELYL
SIGILALGLLSLLAISSLPTVGNSLNWREFSFVQSRLGYMALLMATLHTLTYGWDRGLDL
EQYRFYLPPTFLLVLVLPLAVLLGRLALSLPCVALRLSRIRRGWEKSRAIRFTLPEDECN
GPSQEDISNV
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgccccaggaggagatggagaaacctcttatacttggtggtgccagccccagacacctc
aaaacctcaatttccgatccaggtacccccttggttggcatcctgggcacaggtgacttc
tcccgctccttagccaccaggctggtagcctccgggtaccgggtggtggtgggcagccgc
aaccccaagcgctgtgcctccctctttcccggggaggttgaagtgaccacccagcaccag
gctgccacccaggccgacctggtattcgtggccctcttccccgagcactactccacccta
gctgggctgaaggagccgctaatggggaagactctggtggatgttagttctggtactaag
atcgacagtgataagcagtcaaaagcggagcagctggccaatattttcccagagagcagt
gtggtgaagggcttcaatgtgatctcggcctggagcctgcagaaggggccaagggacggc
agcagacaggtgccgatttgcagtgacagcagtagggccaagagcgctgtactccagatc
tgccgcaatcttggcttcatccctgttgacatgggccgcctctcctctgcccaggagata
gagaacacccccctgtacctcttccccttgtggcgcgtcccatgtctctccaccctcggc
ctcttcctcctcttctacgcctacaacttccttcgtgacgtcgtccacccatatgccatg
gcggggaagagcacattctacaaaattccggtggaggtggtaaacgtgacactcccctct
gtggccttggtgaccctggctctggtctacctgcccggtctcgtggctgccttcctgcag
ctgtcgtggggcaccaagtacaggcgtttccccaactggttggatcgctggctgcagcag
cggaagcagtttggcctctgtgcttttctctgcgcagcgctgcacgccgtctatagcctg
tgtttgcccatgcgcaggtctgctcgctacagtctgctcaacgctgccttcaaacaggtg
aaggtaggccaggaggactcgtgggtagaggaggaggtgtggaggatggagctctatctg
tctataggcatcctggccctgggcctgctctctctgctggctatctcctcactgcccacc
gtgggcaactcgctcaactggagggagttcagcttcgtacagtccagactgggctacatg
gccctgttgatggccaccctccacacgctgacctacggctgggaccggggcttggacctg
gagcagtatcgcttctacctccctcccaccttcctgctggtgctggtcctgccgctggct
gtgctgctggggaggctggctctgtccctgccgtgcgtggctctccggctgagtcgtatc
aggaggggttgggagaagagccgagccatacggttcacactgcctgaagacgagtgtaac
gggccatcacaggaggacatcagtaatgtttga

KEGG   Salmo salar (Atlantic salmon): 106586584
Entry
106586584         CDS       T04363                                 

Definition
(RefSeq) metalloreductase STEAP3-like
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    106586584
   04115 p53 signaling pathway
    106586584
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106586584
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     106586584
Membrane trafficking [BR:sasa04131]
 Exocytosis
  Others
   Others
    106586584
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 106586584
NCBI-ProteinID: XP_014029495
UniProt: A0A1S3PP84
LinkDB
Position
ssa25
AA seq 492 aa
MPLGDMRTPLLSNSFDVPEEPLPCDPGNPTVGILGSGDYSRSLAVRLVACGYRVVVGSRN
PKHIAIGQFPDGVQLLTQREAMVGTEKVVFAALYPEHYHTLVGLRDVLAGKVLVDVSNAT
KLNSGEPSNAERLAELFPESRVVKGFNVVSAWALQTGAHDGSRQVLISSDYPEAKRTVIQ
LARCMSFLAVDMGGLASSRHIEDAPLRLFPSWGGPLMVTFLLILFFYGYNFLRGVLMPYL
SRGQNNFYQLPLETVNETLPAVALVILALVYLPGLWAAALQLVRGTKYSRFPGWLDHWMG
RRKQLGLLSFLCAGLHAVYSMCLTLRKASQYRLLDAAYRQVKAGVEHSWEETQVWRSDLY
LSSGILGLGVLTLLAITSLPSVGNALSWREFTFVQSGLGYVALTLSIMHTLFFSWDFAFF
SFAYPYYMPPTYLLALILPCLVLVGRLFLALPCLAFRLAKIRRGWESPCHHPPQTQEDTA
NGVLPRDLSGDV
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgcctctgggcgacatgaggacacccctgctgtccaactcatttgacgtcccagaggaa
cccctgccctgtgacccgggaaaccccacagtgggcatcctaggctcaggtgattactcc
cgctccctggctgtgcgattagttgcctgtggttatagggtagtggtcggcagccgtaac
ccaaagcatatagccatcggacagtttcctgatggggttcagcttctcacacagcgggag
gcgatggttggcacagagaaggttgtctttgctgctctctaccctgaacactaccacacc
ctggtggggttgagggatgtgctggctgggaaggtgctggtggatgtgagcaacgccacc
aagcttaacagtggagagccgtctaacgctgagaggctggcagagctgttcccagagagc
agagtggtgaagggcttcaatgtggtctcggcctgggccctgcagactggagctcatgac
ggcagcaggcaggtcctgatcagcagtgactatcctgaggccaagagaactgtgatccag
ctggctcgctgcatgagtttcctggccgtggacatgggaggccttgctagctctaggcac
attgaggacgcccccctgcgcctcttcccatcctggggcggccccctaatggtcactttc
ctcctcatcctcttcttctacggctacaacttcctgcgtggcgttctcatgccctacctg
tcccgggggcaaaacaacttctaccagctgcccctggagacggtgaacgagacgctgcca
gcagtggccctggtgatcctggcgctggtctacctcccgggactgtgggctgccgcactg
cagctggtccggggaaccaagtacagccgctttcccggctggttggaccactggatgggg
agacgcaaacagctaggcctgctgagcttcctgtgtgccgggctgcatgcggtctacagt
atgtgtctgaccctgcgcaaggcttctcaatacaggctgctggatgcagcgtacagacag
gtgaaggcgggagtggagcattcctgggaggagactcaggtgtggagatcggacctttat
ctgtcctctggcattctgggacttggtgttctgactcttctggccatcacatctctaccc
tcggtgggtaacgctctcagttggagagagttcacttttgtacagtcagggttgggatac
gttgccttgactctctccatcatgcacaccctcttcttcagctgggactttgctttcttc
tcatttgcttacccttactacatgccccccacatacctgctggcactgatcctgccctgt
ctggtcctggtgggtcggctcttcctggcgctgccctgcctggcgttcagactggcaaag
atacgtcgaggctgggagagtccatgccaccaccctcctcagacccaagaggacacagcc
aatggcgtgctgcccagggacttgagtggtgatgtgtga

DBGET integrated database retrieval system