KEGG   Salmo salar (Atlantic salmon): 106574449
Entry
106574449         CDS       T04363                                 

Definition
(RefSeq) cytoplasmic protein NCK2-like
  KO
K19862  NCK adaptor protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106574449
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   106574449
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3
Other DBs
NCBI-GeneID: 106574449
NCBI-ProteinID: XP_014005821
UniProt: A0A1S3MRL1
LinkDB
Position
ssa16
AA seq 391 aa
MTEEVIVIAKWDYSAQQEQELDIRKNERLWLLDDSKTWWRVRNASNRTGYVPSNYVERKN
SLKKASLVKNIKDTLGLGKTKRKTSARDASPTPSTDAEYPSNGGGGSSAERIYDLSIPAL
VKFAYTAEREDELTLVKGSRVIVMEKCSDGWWRGSSEGRVGWFPSNYVLEEGEEEAVSGD
LSGGYPGQGAGSGGVTNGTIRALHTVQTLYPFSSVTDEELNFEKGEVMEVLEKPENDPEW
WRCRNARGQVGLVPKNYVVILSDDPAPGGGMGSGPHPPHINYTGPARVGKFAGKDWYYGG
VTRHQAECALNERGGQGDFLVRDSESSPSDFSVSLKAMGKNKHFKVALADGVYCIGQRRF
SSMDELVEHYKKAPIFTSEHGDKLYLVKPLL
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgacggaggaggtgatagttatagccaagtgggactactcggctcagcaggaacaggaa
ctggacatccggaaaaacgagcgtctgtggctcctggatgacagtaagacgtggtggagg
gtgaggaacgcctccaaccggaccggctacgtcccctctaactacgtggagaggaagaac
agcttgaagaaggcctcgctggtgaaaaacatcaaagacacactcggcctggggaagaca
aagaggaagacgagtgcccgcgatgcctcgccaacgcccagcacggacgcagagtaccca
tccaatggcggcggaggtagcagcgccgagcgtatctacgacctcagcatcccagccctg
gtcaagttcgcctacacggcggagcgggaagacgagctgacactggtgaaggggtcaagg
gtcattgtcatggagaagtgtagcgacggctggtggcgagggagttctgaaggtcgggta
ggctggttcccctctaactatgtcctggaggagggggaggaggaggccgtctcgggggac
ctaagcggaggttacccaggacagggggcagggtcgggaggggtgaccaacgggaccatc
agggcactccacactgttcagacactgtaccccttcagctctgtgaccgacgaggagctg
aactttgaaaagggcgaggtgatggaggtgctggagaaaccggagaacgaccctgagtgg
tggcggtgtcggaacgcccgtggacaggtgggcctggtgccaaagaactatgtggttatc
cttagcgacgatccggcccccgggggtgggatgggctcgggcccccacccgccccacatc
aactacacagggccggcccgcgtgggaaagtttgccgggaaggactggtactatggggga
gtgaccaggcatcaggcagagtgtgcgctcaacgagagaggaggtcagggagacttcctg
gtcagagacagcgaatcatcgcccagtgatttctccgtgtccctcaaggcgatgggaaag
aacaagcatttcaaggttgcgctggcggacggcgtctactgtatcggccagagacgcttc
agcagcatggacgaactggtggagcactacaagaaagccccgatcttcaccagcgaacat
ggagacaaactctacctggtcaaaccgctgctgtga

KEGG   Salmo salar (Atlantic salmon): 106575249
Entry
106575249         CDS       T04363                                 

Definition
(RefSeq) cytoplasmic protein NCK2-like
  KO
K19862  NCK adaptor protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106575249
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   106575249
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 106575249
NCBI-ProteinID: XP_014007115
UniProt: A0A1S3MVA2
LinkDB
Position
ssa17
AA seq 391 aa
MTEEVIVVAKWDYSAQQEQELDIRKNERLWLLDDSKTWWRVRNTSNRTGYVPSNYVERKN
SLKKASLVKNIKDTLGLGKTKRKTSARDASPTPSTDAEYPSNGGGGSSGERIYDLSISAL
VKFAYTAEREDELTLVKGSRVIVMEKCSDGWWRGSSEGQVGWFPSNYVLEEGEEEAVSGD
LSGGYPGQGAGLGGVINGTTRALHTVQTLYPFSSVTDEELNFEKGEVMEVLEKPENDPEW
WRCRNARGQVGLVPKNYVVILSDDPAPGGGMGSGPHSPHINYTGPARVGKFAGKDWYYGG
VTRHQAECALNERGGQGDFLVRDSESSPSDFSVSLKAMGKNKHFKVALAEGVYCIGQRRF
SSMDELVEHYKKAPIFTSEHGDKLYLVKPLL
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgacggaggaggtgatcgttgtagccaagtgggactactcggctcagcaggaacaggaa
ctggacatccggaaaaacgagcgtctgtggctcctggatgacagtaagacgtggtggagg
gtgaggaacacctccaaccgcaccggctacgtcccctccaactacgtggagaggaagaac
agcttgaagaaggcctcgctggtgaaaaacatcaaagacacactcggcctggggaagacg
aagaggaagacgagtgcccgcgatgcctcgccaacgcccagcacggacgcagagtacccg
tccaatggcggcggaggtagcagcggcgagcgtatctacgacctcagcatctcagccctg
gtcaagttcgcctacacggcggagcgggaagacgagctgacactggtgaaggggtcaagg
gtcattgtcatggagaagtgtagcgacggctggtggcgagggagttctgaaggtcaggta
ggctggttcccctctaactatgtcctggaggagggggaggaggaggccgtctcgggggac
ctaagcggaggttacccagggcagggggcagggttgggaggggtgatcaacgggacaacc
agggcgctccacactgtccagacgctgtaccctttcagctctgtgacagacgaggagctg
aactttgaaaagggcgaggtgatggaggtgctggagaaaccggagaacgaccctgagtgg
tggcggtgtcggaacgcccgtggacaggtgggcctggtgccaaagaactatgtggttatc
cttagcgacgatccggcccccgggggtgggatgggctcgggcccccactcgccccacatc
aactacacagggccggcccgcgtgggaaagtttgccgggaaggactggtactatggggga
gttaccaggcatcaggcagagtgtgcgctcaacgagagaggaggtcagggagacttcctg
gtcagagacagcgaatcatcgcccagtgatttctccgtgtccctcaaggcgatgggaaag
aacaagcacttcaaggttgcactggcggagggggtctactgtatcggccagagacgcttc
agcagcatggatgaactggtggagcactacaagaaagccccgatcttcaccagcgaacat
ggagacaaactctacctggtcaaaccgctgctgtga

KEGG   Salmo salar (Atlantic salmon): 106579755
Entry
106579755         CDS       T04363                                 

Definition
(RefSeq) cytoplasmic protein NCK1-like
  KO
K07365  NCK adaptor protein 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106579755
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   106579755
SSDB
Motif
Pfam: SH3_9 SH3_1 SH3_2 SH2 SH3_3 hSH3 DUF1179
Other DBs
NCBI-GeneID: 106579755
NCBI-ProteinID: XP_014015393
UniProt: A0A1S3NIZ9
LinkDB
Position
ssa19
AA seq 272 aa
MSSSFTSLRYQTGIGKVKRKTGMRDTASNADADMYSDNGERLYDLNLPALVKFSYTAERE
DELSLVKGTHVIVMEKCSDGWWRGGYQGCSGWFPSNYVTEDADGTAGGGGGLGDPAGSLT
EKIATVVHSASNGNRVLHSVQALYPFSSGNDEELNFEKGEVMEVVEKPDNDPEWWKCRKA
DGQLGLVPKNYVTVLPPQQDSTTQNASPGPAGPPTPDCDYISPATVGRFAGKQWYYGKVT
RHQAEVALNQRGAEGDFLIRDSESSVSPGRYL
NT seq 819 nt   +upstreamnt  +downstreamnt
atgtcctcctcttttacaagcctgagataccagaccggcattgggaaggtgaagcggaaa
acggggatgcgtgacacggcctccaacgcggacgctgacatgtactccgacaacggcgag
cgcctgtacgacctcaacctgccggcgctcgtcaagttcagctacaccgccgagcgggag
gacgagctctcgttggtcaagggcacccacgtcatcgtcatggagaagtgtagcgatggc
tggtggcgtggggggtaccagggttgttccgggtggttcccttccaactacgtgacggag
gacgcagacgggacagcggggggaggaggaggtttgggggacccggcggggtcgctgacg
gaaaagatagcgacagtagttcacagtgcgtctaacgggaaccgggtcctccactcggtg
caggcgctctaccctttcagctcggggaacgacgaggagctgaactttgagaagggagag
gtgatggaggtggtagagaaaccagacaacgaccctgagtggtggaagtgccgtaaagca
gatggacagctgggactagtgcctaagaactacgtcactgtgctacctccacagcaggac
tccactacccagaatgcctcaccgggccccgcggggccgcccacgcccgactgcgactac
atctctccggccacggtggggcggtttgcggggaagcagtggtactatggcaaggtgacg
cgacatcaggcggaggtggctctcaaccagagaggagcggagggagacttcctcatcaga
gactctgagtcatcggtgagtcctggccgttatctataa

KEGG   Salmo salar (Atlantic salmon): 106581983
Entry
106581983         CDS       T04363                                 

Definition
(RefSeq) cytoplasmic protein NCK2-like
  KO
K19862  NCK adaptor protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106581983
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   106581983
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2 P_C
Other DBs
NCBI-GeneID: 106581983
NCBI-ProteinID: XP_014020071
UniProt: A0A1S3NXU1
LinkDB
Position
ssa21
AA seq 418 aa
MMEEVTVVAKWDYTAQQDQELDIRKNERLTLLDDSKTWWRVRNASTQTGYVPSNYVERKN
SLVKKASLVKNLKDTLGLGKGRRKQSARDASPTPSTDAEYPSNGSGGGGGGGGGGGGGAE
RIYDLTILAVVKFSYMAEREDELTLAKGSRVTVMEKCSDGWWRGSQGGRVGWFPSNYVLE
DPAEREGEGGGGGRDSPGYPGQGRGATMTNGRAGGGGGRDGEGSGALHLVQTIYPFNSVT
EEELNFEKGEVMEVVEKPENDPEWWRCRNAQGLVGLVPKNYVLVLNDADGPPGLPALPQS
PPGSSQIRYVGPAIVGKFAGRDWYYGGVTRHQAELVLNERGKEGDFLIRDSESSPSDFSV
SLKAPGKNKHFKVQCSEEVYCIGQRRFSSIDELVEHYKKAPIFTSQHGDKLYLVKPLL
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgatggaggaggtgacagttgtagccaagtgggactacacggcccagcaggaccaggaa
cttgacatcaggaagaatgagcggctcaccctgctggacgacagcaagacgtggtggagg
gtgaggaacgcctccacccagaccggctacgtcccctccaactacgtggagcgcaagaac
agcctggtgaagaaggcctcgctggtcaagaacctcaaagacacactgggactgggtaag
ggcagaaggaagcagagtgcccgtgatgcctctcccacacccagcacggatgcagagtac
ccttccaatgggagtgggggaggaggaggaggaggaggaggaggtggaggcggtgccgaa
cgcatctacgacctcaccatcctggccgttgtcaagttctcgtacatggcggagcgcgag
gatgagctgaccctagccaaggggtcccgggtcacggtgatggagaagtgcagtgacggc
tggtggcggggcagccagggaggtcgcgtgggctggttcccctccaactacgtcctggag
gaccccgcagagagagagggtgaggggggtggaggaggaagggactccccaggttatcca
gggcagggcaggggggccacgatgaccaacgggcgggcgggaggtggtggcggccgggat
ggagaaggaagtggtgcgctccatctggtccagactatttacccgttcaactcagtgacg
gaggaagagctgaactttgagaagggagaggtgatggaggttgtggagaaaccagagaat
gacccagagtggtggcgctgcaggaacgcccaaggcctggtgggcctagtgcctaagaac
tacgtgctggtgctgaatgacgctgacgggcctcccgggctccccgccctgccacagtca
ccccctggctcctcacagatccgctacgtggggccggcgatcgtgggcaagtttgcaggc
agggactggtactacggaggggtgaccagacaccaggcagagctggtcctcaacgagagg
gggaaggagggggacttcctcatacgggacagcgagtcatcgcccagtgatttctctgtc
tctctgaaggcgcctgggaagaacaagcacttcaaggtgcagtgttcagaggaggtgtac
tgtatcggccagcgcaggttcagctccattgatgaactggtggaacactacaagaaagcc
cccatcttcaccagccaacacggagacaagctctacctggtcaaaccgctgctgtga

KEGG   Salmo salar (Atlantic salmon): 106586771
Entry
106586771         CDS       T04363                                 

Gene name
nck2
Definition
(RefSeq) NCK adaptor protein 2
  KO
K19862  NCK adaptor protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106586771 (nck2)
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   106586771 (nck2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 106586771
NCBI-ProteinID: XP_014029853
UniProt: A0A1S3PRJ0
LinkDB
Position
ssa25
AA seq 416 aa
MTEEVTVVAKWDYTAQQDQELDIRKNERLTLLDDSKTWWRVRNASNQTGYVPSNYVERKN
SLVKKASLVKNLKDTLGLGKGRRKQSASDPTPSTDAEYPSNGSGGGGGGGAERVYDLNIL
AVVKFSYVAEREDELTLAKGSRVMVMEKCSDGWWRGSQGGRVGWFPSNYVLEDPAEGEGG
RGGRDSPGYPGRGREATMTNGRAGGGGSRGGEGGGALQLVQTLYPFSSVTEEELNFEKGE
VMEVVEKPENDPEWWRCRNTRGLVGLVPKNYVLVLNDTNGPPGLPALPLSPPGSPQIGHV
TPACEGKFGGRDWYYGGVTRHQAELVLNERGEEGDFLIRDSESSPSDFSVSLKAPGKNKH
FKVQCSEGVYCIGQRKFSSIDELVEHYKKAPIFTSEQGDKLYLVKPLPAPQLSSTC
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgacggaggaggtgacagttgtagccaagtgggactacacggcccagcaggaccaggaa
cttgacatcaggaagaatgagcggctcaccctgctggacgacagcaagacgtggtggagg
gtgaggaacgcctccaaccagaccggctacgtcccctccaactacgtagagcgcaagaac
agcctggtgaagaaggcctctctggtcaagaacctcaaagacacactgggactgggtaag
ggcagaaggaagcagagtgccagtgaccccacacccagcacggatgcggagtatccctcc
aatgggagtggtggtggcggaggaggaggggccgagcgggtctacgacctcaacatcctg
gctgtggtcaagttctcgtacgtggcggagcgcgaggacgagctgaccctagccaagggg
tcccgggtcatggtgatggagaagtgcagtgacggttggtggcggggcagccaggggggc
cgtgtgggctggttcccctctaactatgtcctggaggaccccgcagagggggaagggggt
agaggaggaagggactccccaggttatccagggaggggcagggaggccacgatgaccaac
ggacgggcgggaggtggtggcagccggggtggcgagggcggtggtgcgctccagctggtc
cagactctgtacccgttcagctcagtgacggaggaggagctgaactttgagaaaggagag
gtgatggaggttgttgagaaacctgagaatgacccagagtggtggcgctgccggaacacc
cgcggcctggtgggcctggtgcccaaaaactacgtgctggtgctgaatgacaccaacggg
cctcccgggctccccgcccttccgctgtcgccccctggttccccacagatcggccacgtg
accccggcgtgcgagggcaagtttggcggcagggactggtactacggaggggtgaccagg
caccaagcagagctggtcctcaacgagagaggagaggagggggacttcctcatacgtgac
agcgagtcatcgcccagtgatttctctgtgtctctgaaggcgcctgggaaaaacaagcac
ttcaaggtgcagtgttcagagggggtctactgtattggccagcgcaagtttagctccata
gatgaactggtggaacactacaagaaagcccccatcttcaccagtgaacaaggagacaag
ctctaccttgtcaaaccgctgcccgcaccccagctatcctcaacatgctga

KEGG   Salmo salar (Atlantic salmon): 106590688
Entry
106590688         CDS       T04363                                 

Definition
(RefSeq) cytoplasmic protein NCK1-like
  KO
K07365  NCK adaptor protein 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106590688
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   106590688
SSDB
Motif
Pfam: SH3_9 SH3_1 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2 DUF1179
Other DBs
NCBI-GeneID: 106590688
NCBI-ProteinID: XP_014037323
UniProt: A0A1S3QBF0
LinkDB
Position
ssa29
AA seq 396 aa
MTEEVIVIAKWDYSAQQEQELDIRKNERLWLLDDSKTWWRVRNASNRTGYVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKTGMRDTASNADADTSPDNGERLYDLNLPALVKFSYTA
EREDELSLVKGTRVIVMEKCSDGWWRGGYQGCSGWFPSNYVTEDADGTAGGGGDDSLGDP
AGSLTEKLAAVVHSASNGNRVLHSVQALYPFSSGNDEELNFEKGEVMEVVEKPDNDPEWW
KCRKADGQLGLVPKNYVNVLPPQQDSTTQNASPGPAGPPTPDCDYISPATVGRFAGKQWY
YGKVTRHQAEVALNQRGAEGDFLIRDSESSPNDFSISLKAQGKNKHFKVQLKDGVYCIGQ
RQFSSLEDLVEHYKKAPIFTSEQGDKLYLVKALAAS
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgacggaggaggtgatagttatagccaagtgggactactcggctcagcaggaacaggaa
ctggacatccggaaaaacgagcgtctgtggctcctggatgacagtaagacgtggtggagg
gtgaggaacgcctccaaccggaccggctacgtcccctctaactacgtggagaggaagaac
agcgccaggaaggcttccatcgtcaagaacctcaaagacacactaggcatcgggaaggtg
aagcggaaaacgggaatgcgtgacacggcctccaacgcggacgccgacacgtcccccgac
aacggcgagcgcctgtacgacctcaacctgccggcgctcgtcaagttcagctacaccgcc
gagcgggaggacgagctctcgttggtcaagggtacgcgcgtcatcgtcatggagaagtgt
agcgatggctggtggcgtggggggtaccagggttgttccgggtggttcccttccaactac
gtgacggaggacgcagacgggacagcggggggaggaggggatgacagtttgggggacccg
gcggggtcactgactgagaagctagcagcagtagttcacagtgcgtctaacgggaaccgg
gtcctccactcggtgcaggcgctctaccctttcagctcggggaacgacgaggagctgaac
tttgagaagggagaggtgatggaggtggtagagaaaccagacaacgaccctgagtggtgg
aagtgccgtaaagcagatggacagctgggactagtgcctaagaactacgtcaatgtgcta
cctccccagcaggactccactacccagaatgcctcaccgggccccgcggggccgcccacg
cccgactgcgactacatctctccggccacggtggggcggtttgcggggaagcagtggtac
tatggcaaggtgacgcgacatcaggcggaggtggctctcaaccagagaggagcggaggga
gacttcctcatcagagactctgaatcatcgcccaatgatttctccatctctctgaaggcc
caggggaagaacaagcattttaaggttcagttgaaggatggtgtgtactgcatcggccag
aggcagttcagttctctggaggacttggtggaacactacaagaaggctcccatcttcacc
agcgagcagggagacaagctctacttagttaaggccctggctgcctcttga

DBGET integrated database retrieval system