KEGG   Salmo salar (Atlantic salmon): 106574911
Entry
106574911         CDS       T04363                                 

Definition
(RefSeq) multiple epidermal growth factor-like domains protein 8
  KO
K23664  multipile epidermal growth factor-like domains protein 8
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106574911
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Laminin domain-containing proteins
  Laminin EGF-like domain-containing proteins
   106574911
SSDB
Motif
Pfam: Kelch_3 Kelch_5 Kelch_4 Kelch_6 Kelch_1 CUB Kelch_2 Laminin_EGF PSI EGF_CA EGF_3 EGF
Other DBs
NCBI-GeneID: 106574911
NCBI-ProteinID: XP_014006521
UniProt: A0A1S3MUS9
LinkDB
Position
ssa02
AA seq 3061 aa
MASLLHVPLLGLLLVAVAPGCWAGDCKGHRQVLRGPPGYVTDGPGNYSVNGNCEWLIKAP
SSNYRIVLNFTFMETECTYDYLFVYDGDSYQNPLLASLSGTTLPQPIEAKSGKMLLHLFS
DANYNLLGFNATYSFSVCPGACGGHGRCDTASSLCQCHLGWGGADCSTPLCPQACILHGT
CDKRGERCLCSSDFLGQSCQLGLRDDSGAGQWWQVSGGDPYTPPRTGSAGVYLSSTGAMY
LFGGFDLNRALGDLVKYNFSLNQWENRFYGHSPAARHSHTAVEWMGNMVIFGGELASGAL
ASDVWMYRPIQDDWQQLGQSHSPGAPRVANHAAAVVDNYLYIFGGRTEEDMFSSSLYRFG
LRGSGVWEAVQPTGGKPPATAGHSMVFHPPSRALLVYGGHRPTTARFSVRVNSTDVFHVD
RRFWTSFRSRFPATGPRERAFHSATVIGNYMVVYGGNVHIHYQEEKCYDEEIFFYHLGCH
QWVLAGESLQHRGEAVRGRYSHVAAVMEGRVLLVAGGYSGIARGDLVAYKVPLFVSSDPG
DRVSQEDAVCAEAPDESMCLKNPECSWCEGRCREYQPTNPCGSTGCLGLARFLSDCQSCL
VFSGAPGSLPRAPGDFGWCVQNESCLPVSDQSACRVDQISGAYGWWGERTRFLTSLLSCR
TENYVPGLHLLTFQHPRNDSQPDKVSILRSTSIILSPTTEMDVTLQFRGFIHPLWGAPPP
APPPTETVSMWARIQRLHFEARMAAGPNSLQLKELVGRWAAHQEKETKLLSRPDMGRLFP
NLTRGNRYLVQAEGYLNNSGSGQTSEMALTWNRTALPGGSEISFLFLEPFRSGSCSGYQS
CLACLSDQSCGWCPSLGRCLFRALPDLEPCPEDQGGGERHLLLAPPQCTLCEEYRDCSAC
TQDPYCEWQINSSKKGDYQCSRRGRLDGSIRDPEGCPKVCNQRRTCGECLSNSSQCAWCE
SAQACFYFAAYLTKYPYGECRDWYDSVHSVPQCKQCSALVTCTDCLQTFQCGWCGDYNNP
TIGRCLRGDWGGMDDPSVYNCSVAVDEVRATSPEPQTLAPPRPMEMEMELEHLEEGERDP
VWSYPTCPDVEECRLGLHSCHPFATCVNTPTSFECHCERGYTGDGTLHCNQTCYNECREG
QCSGSPRFECECSLGWTSDPATLVLSGVECDVDCGCNFHSTCITAPGICDHCQDWTMGLQ
CEHCRPGSFGSALAGGGGCVPCQCNGHGGPLLGYCHNQTGQCYCTHHTQGPHCESCLPGY
YGDPRNNGTCFRQCQGRSVILSHQSPLSELPISSSMGWRGGVGGKGGLSHCLWVLSVSEN
LAPCVPGELCPPVALTLHPDSYTQCTSSYVYVFDGLPRFLSNGVVHSDHNLIGAFCGTTR
TQPITVEATSGVISVYFEANVSSDRPQGFNASFWVRRCRQGSEAGEDGSPVCQGGAQCSG
GLCQCTPGYGGPYCDRPLCPGGCGLAEGRGSCNLSLGVCVCADGWGGSDCSTPLDSSSLV
WETLLDTQLTANQAHRFLHRMGHSLVSGPQGNLWMYGGLSLSEGILGNVYRYSVLERRWT
QMLTSSVEEGSTPSPRYHHASALLASHEPLSDAQGATHNLMLVVGGVTQKGVAMDTWSLN
LSSLVWRQHKSSVLPPVAGHTLTVRRDTSMLLIGGYSPENGFNHHLLEFNIHSGNWTVTP
HTGTPPTGLYGHSAVYHEQTDAVYVFGGYRFHVETVEPSGELYSLYYANLTWSLLVPSQG
NKPLSRFFHAAALIKDTMVIVGGRTGVEDYSNTVSLYQINCNTWIQPDSAVGEPVNRSVS
LAMVGWGGRLFLSGGFNGVTLGRLLTLTLPSDPCALLPTPEACNTTTGSCVWCRGTCAAS
DTAERLGCSIGQSPCSPTPRLPDQCRRLKTCSECLARHPRTFSSPSQSQSALQCKWCTNC
PEGACISSTVSCTSEHDCRINQREIFLSSNCTETSCEASDCPKCTASGKCMWTRQFKRTG
ETRRILSVNPTYDWTCFSYALLNVSPMQVESSPPLPCPPPCHHLSTCSLCLGSRGSDGGW
QHCMWSMALQQCVSPSFVPLRCEAGQCGRLLSGGDSCSPQCAQLTQCSQCIAWPQCGWCA
ARGGNGAGRCQQGGLDGVSEGVCPQRNSSWSFLHCPEEDECANGNHHCNITQDCHDLTQG
YHCTCKQGYVLSRAGGGRVTQKGVAMDTWSLNLSSLVWRQHKSSVLPPVAGHTLTVRRDT
SMLLIGGYSPENGFNHHLLEFNIHSGNWTVTPHTGTPPTGLYGHSAVYHEQTDAVYVFGG
YRFHVETVEPSGELYSLYYANLTWSLLVPSQGNKPLSRFFHAAALIKDTMVIVGGRTGVE
DYSNTVSLYQINCNTWIQPDSAVGEPVNRSVSLAMVGWGGRLFLSGGFNGVTLGRLLTLT
LPSDPCALLPTPEACNTTTGSCVWCRGTCAASDTAERLGCSIGQSPCSPTPRLPDQCRRL
KTCSECLARHPRTFSSPSQSQSALQCKWCTNCPEGACISSTVSCTSEHDCRINQREIFLS
SNCTETSCEASDCPKCTASGKCMWTRQFKRTGETRRILSVNPTYDWTCFSYALLNVSPMQ
VESSPPLPCPPPCHHLSTCSLCLGSRGSDGGWQHCVWSMALQQCVSPSFVPLRCEAGQCG
RLLSGGDSCSPQCAQLTQCSQCIACPQCGWCAARGGNGAGRCQQGGLDGVSEGVCPQRNS
SWSFLHCPEEDECANGHHHCNITQDCHDLTQGYHCTCKQGYVLSRVSGQCEPVCAQGCVN
GTCVSPGVCQCHFGFVGDNCSSQCRCNKHSNCKGVSEPDKCLECKNNTMGDHCEKCKPLY
VGSAVGGGTCRPCREFCRGNSAVCLSRDEHKRALDHPQDHPLDPDSIVQWVSEGPTEDSA
VCVSCQNNSVGDKCESCLSGYFLLQGNCDKCQCNGHADTCNEHDGTGCPCQNNTETSSCL
SSPQSDRKDCYRTQCAKCKDSFNGTPVNGRQCYRQFNVDNECCFDPTSQTNCFHDPTIRN
LPKGRTVFFAAQPKFTNVDIRVTIDVTFGEVEVYVSNSHDTFIVEVDLHTGIHAIKIEDE
S
NT seq 9183 nt   +upstreamnt  +downstreamnt
atggcctccctcctccatgtccccctgctggggttgctgctggtggctgtggcccctggg
tgttgggcaggagactgtaagggccacagacaggtgctcaggggccccccagggtacgtc
acagacgggccagggaactactctgtaaacgggaactgcgagtggctcatcaaagccccc
agcagcaattaccgtatcgtcctgaactttaccttcatggagacagaatgcacatatgat
tacctgttcgtctatgatggagactcctaccagaaccctctactggccagtctgagtggc
accaccctgccgcagcccatagaagccaagtctggcaagatgctgctccacctcttcagt
gatgccaactacaacctcctgggcttcaatgccacctactcgttctctgtgtgccctggg
gcctgcggaggtcacgggcgctgtgacacggcctcgtccctgtgccagtgccatctgggc
tggggaggagccgactgcagcacccctctatgtccccaggcctgcatcctgcacggcacc
tgtgacaagagaggagagcgttgtctctgcagctcagacttcctgggccagagctgtcag
ctgggtctccgtgatgacagtggggcggggcagtggtggcaggtgagtgggggcgacccc
tacacgcccccccggaccggctcggctggggtctacctgtcctccactggagccatgtac
ctgtttggagggtttgacttgaaccgagctttgggggacctggttaaatacaacttcagc
ttgaaccaatgggagaacagattttatggacactccccagcggctcgtcactcccacacg
gcagtagagtggatggggaacatggtgatcttcggaggagagctcgcgagcggcgcttta
gccagcgacgtctggatgtaccgcccaatccaggatgactggcagcagctcggacaatcc
cattcgcccggggcaccgagagtggccaaccatgcagcagctgtagtggacaactatctc
tacatatttggaggtcgtacggaagaggacatgttctcgtcatctctgtatcggtttggt
ctgcgggggtctggggtgtgggaagcggtgcagcccactggggggaagccccccgccaca
gcaggccactccatggtgttccaccccccgtcccgggccctgctggtctacgggggccac
aggcctaccactgccaggttcagtgtacgtgtgaactccacggatgtattccacgtggac
cggaggttctggacctcgttccgttcccgtttcccagccacaggccccagggagagagcc
ttccactcagccaccgtcatcggaaactacatggtggtctatggggggaatgtgcacatc
cactaccaggaggagaagtgttatgatgaggaaatcttcttctaccacctggggtgtcat
cagtgggtgttagctggggagagcctccaacacagaggagaggctgtgagagggcggtac
tcccatgtagctgctgtgatggagggcagggtgctgctggttgccgggggttacagtggt
attgcccgtggagacctggtggcgtacaaagttccactttttgtgagcagcgacccagga
gaccgggtgagtcaagaagacgctgtgtgtgccgaggcaccagacgagagcatgtgtctg
aagaacccagaatgcagctggtgtgagggccgctgtcgggagtaccaacccaccaacccg
tgtggcagcacagggtgcctgggcctggctcgcttcctgtctgactgccagtcctgcctg
gtgttcagtggggctccaggttccctgccccgcgcccccggtgacttcggctggtgtgtc
cagaacgagtcctgcctacctgtgtcagatcaaagtgcttgccgtgtggaccagatctca
ggggcgtacggctggtggggggagcgcacccgtttcctcacctccctcctttcctgtcgc
actgagaactatgtcccgggactgcatctgctcaccttccagcacccccgcaatgattcc
cagcctgacaaggtgtccatcctgcgcagcacctccatcatcctcagccccaccacagag
atggacgtcaccctgcagttccggggcttcatccaccccctgtggggcgcccctccacct
gcgccccctcccaccgagactgtttccatgtgggcccggatacaaaggctacactttgag
gcccgcatggctgctggacccaactccctgcaactgaaggagttggtaggtcgttgggca
gctcaccaggagaaggagacgaagctgctgtcccgtcctgacatgggtcgtctgtttccc
aacctgacccgagggaaccgctacctggtccaggctgagggatacctcaacaactcaggc
tctggacagactagtgagatggccttgacctggaacagaaccgctctgcccggcggaagt
gagatttccttcctgttcttggagccattccgttctggctcttgctcggggtaccagtct
tgcttggcgtgtctgtcagaccagtcctgtggctggtgcccatctctgggccgctgtctg
ttccgtgcgctgcctgacctggagccctgcccggaggaccaggggggaggggagcgccac
ctgctgctggccccgccacaatgcaccctctgtgaggagtacagggactgctccgcctgc
actcaggacccctactgtgagtggcagatcaactccagcaagaagggtgactaccaatgc
agccgacggggaagactggatggatccattcgcgacccagaggggtgccctaaagtctgc
aaccagaggaggacttgtggggagtgtctgtctaactccagtcagtgtgcgtggtgtgag
tcggcccaggcctgcttctacttcgctgcctacctcaccaagtatccctacggagagtgc
agggactggtatgacagtgttcactcagtgccccagtgtaagcagtgctcagctctggtc
acctgtacagactgtctccagacgtttcagtgcggctggtgtggagactacaacaacccc
accatcggcaggtgtctacgaggagactggggagggatggacgacccctctgtgtataac
tgcagtgtggctgtggatgaagtacgggctaccagtcctgagccccagaccttggccccc
ccgcggcccatggagatggagatggagctggagcacctggaggagggagagagggaccca
gtctggtcctaccccacctgtcccgatgtggaggagtgcaggctgggcctccacagctgc
caccccttcgccacctgcgtaaacacccccacctcctttgagtgccactgtgagaggggc
tacaccggggacggcaccctgcactgcaaccagacttgttataatgagtgtcgtgagggc
cagtgcagcggcagcccgcggttcgagtgtgagtgttccctgggctggacatctgaccca
gccaccctggtgctgagcggggtggagtgtgacgtggactgtggctgtaacttccacagc
acctgtatcactgccccaggcatctgtgaccactgccaggattggacaatgggtctccag
tgtgagcactgtcgaccagggagttttggttctgcgctggccgggggcgggggctgtgtg
ccctgccagtgtaacggccatggaggccccctcctgggctactgccacaatcagacaggc
caatgctactgcacacaccacacccagggaccacactgtgaatcctgcttgcctggatac
tacggagaccccaggaataatggcacctgtttccgtcagtgtcaggggcgctctgtgatc
ctgtcccaccagtcacccctctctgagctccccatctcgtcctccatggggtggcgaggg
ggagtcggggggaaggggggactctcccactgtctgtgggtcctgtctgtctctgagaac
ctggccccctgtgtgccgggcgagctgtgccctcctgtggctctcaccctgcacccagac
tcctacacacagtgcactagctcctacgtttacgtgtttgacggcctgcctcgtttcttg
agcaacggggtggtgcactcggaccacaacctgattggcgcattctgtgggacgacccgg
actcagccaatcacagtggaggccacttcaggtgtgatctctgtctactttgaagccaac
gtctcgtccgaccgtcctcagggtttcaacgcctccttctgggtgcggcgctgtcgccag
ggttctgaggcgggggaggatgggtcacccgtatgccagggaggggcgcagtgcagcggg
gggctgtgccagtgtactccggggtatgggggaccgtactgcgacaggcccctctgtccc
gggggctgtgggctagcagagggccgaggctcctgcaacttgtctctgggagtgtgtgtg
tgtgcagacggttggggtggctctgactgctccacccctctggactccagcagcctagtt
tgggaaaccctactggacacacagctcacagcgaaccaggcccacaggttcctccaccgg
atgggccattctctagtgtctgggccccaggggaacctctggatgtatggaggcctctct
ctctcagagggcatcctgggaaacgtctacaggtactctgtgttggagcggcgctggact
cagatgctgaccagctcagtggaggaaggctccacccccagcccccgctaccaccatgcc
tctgcccttctggccagtcacgagcctctctccgacgcccagggagccactcacaacctc
atgctggtggtgggcggtgtcacgcagaagggcgtcgccatggatacatggagcctcaac
ctcagcagtctggtgtggagacagcacaagagctcagtgctgccaccggtggcaggtcat
actctaacggtgcgtcgggacacctctatgctgctcatcggaggttactctccagagaac
ggcttcaaccatcacctgctggagttcaacatccactctggcaactggaccgtcaccccc
cacaccggcacacctcctacaggtctgtatggccactcggctgtgtaccacgagcagacg
gacgccgtgtacgtgttcggaggctaccgcttccacgtggagacagtggagccctcagga
gagctctacagtctctactatgccaacctcacctggtccctactggtcccctcacagggg
aataagcccctgtctcgtttcttccacgctgcagccctgataaaagacactatggtgatc
gtgggagggaggacaggagtggaggactacagcaacacagtgtctctgtaccagatcaac
tgtaacacctggatacagccagactcggcggtgggcgagccggttaaccgttcagtctct
ctggccatggtgggctggggtgggcggctgttcctctctggggggttcaacggggtcacc
ctggggcgtctcctcaccctgacccttccctctgacccctgtgccttgctgcccacgccc
gaggcctgcaacaccaccacaggcagctgtgtctggtgcaggggcacctgcgccgcctcc
gataccgctgagagactgggctgttccattggtcagtctccctgctcccccacccctcgt
ttaccagaccagtgtcgcagactgaagacctgcagcgagtgtctggcacgccaccccagg
accttctctagcccctcacagtcccagtctgctctgcagtgtaagtggtgcaccaactgt
ccagagggagcatgcatcagcagtacagtcagctgcacctccgaacacgactgcaggatc
aaccagagagagatcttcctgtccagcaactgtactgagaccagctgtgaggcctccgac
tgccccaagtgcaccgcctcagggaagtgcatgtggacacgccagttcaaacgcaccggc
gagaccaggcgcatcctgagtgtgaaccccacctacgactggacgtgcttcagctacgcc
ctgctcaacgtgtcccccatgcaggtggagtcctccccccctctgccctgcccgcccccc
tgccaccacctcagcacttgcagcctctgcctgggctcccggggctcagacgggggctgg
cagcactgtatgtggagcatggcactgcagcagtgtgtgagtccgtccttcgtgcctctg
cgctgtgaggcgggtcagtgtggtcgtctgctgtctggtggggactcctgctccccccag
tgcgcccagctcacccagtgctctcaatgcatcgcctggccccagtgtggctggtgtgct
gcccgggggggcaacggggctggacgctgccagcagggaggcctcgacggtgtgagtgag
ggagtgtgtccccagaggaacagcagctggtccttcctccactgcccagaggaggatgag
tgtgccaacggcaaccaccactgtaacatcacccaggactgccatgacctgacccaggga
taccactgcacctgcaagcagggctacgttctcagccgtgctggtggtgggcgggtcacg
cagaagggcgtcgccatggatacgtggagcctcaacctcagcagtctggtgtggagacag
cacaagagctcagtgctgccaccggtggcaggtcatactctaacggtgcgtcgggacacc
tctatgctgctcatcggaggttactctccagagaacggcttcaaccatcacctgctggag
ttcaacatccactctggcaactggaccgtcaccccccacaccggcacacctcctacaggt
ctgtatggccactcggctgtgtaccacgagcagacggacgccgtgtacgtgttcggaggc
taccgcttccacgtggagacagtggagccctcaggagagctctacagtctctactatgcc
aacctcacctggtccctactggtcccctcacaggggaataagcccctgtctcgtttcttc
cacgctgcagccctgataaaagacaccatggtgatcgtgggagggaggacaggagtagag
gactacagcaacacagtgtctctgtaccagatcaactgtaacacctggatacagccagac
tcggcggtgggcgagccggttaaccgttcagtctctctggccatggtgggctggggtggg
cggctgttcctctctggggggttcaacggggtcaccctggggcgtcttctcaccctgacc
cttccctctgacccctgtgccttgctgcccacgcccgaggcctgcaacaccaccacaggc
agctgtgtctggtgcaggggcacctgcgccgcctccgataccgctgagagactgggctgt
tccattggtcagtctccctgctcccccacccctcgtttaccagaccagtgtcgcagactg
aagacctgcagcgagtgtctggcacgccaccccaggaccttctctagcccctcacagtcc
cagtctgctctgcagtgtaagtggtgcaccaactgtccagagggagcatgcatcagcagt
acagtcagctgcacctccgaacacgactgcaggatcaaccagagagagatcttcctgtcc
agcaactgtactgagaccagctgtgaggcctccgactgccccaagtgcaccgcctcaggg
aagtgcatgtggacacgccagttcaaacgcaccggcgagaccaggcgcatcctgagtgtg
aaccccacctacgactggacgtgcttcagctacgccctgctcaacgtgtcccccatgcag
gtggagtcctccccccctctgccctgcccgcccccctgccaccacctcagcacctgcagc
ctctgcctgggctcccggggctcagatgggggctggcagcactgtgtgtggagcatggca
ctgcagcagtgtgtgagtccgtccttcgtgcctctgcgctgtgaggcgggtcagtgtggt
cgtctgctgtctggtggggactcctgctccccccagtgcgcccagctcacccagtgctct
cagtgcatcgcctgtccccagtgtggctggtgtgctgcccgggggggcaacggggctgga
cgctgccagcagggaggcctcgacggtgtgagtgagggagtgtgtccccagagaaacagc
agctggtccttcctccactgcccagaggaggatgagtgtgccaacggccaccaccactgt
aacatcacccaggactgccatgacctgacccagggataccactgcacctgcaagcagggc
tacgttctcagccgtgtgtcaggccagtgtgagccggtgtgcgctcagggctgtgtcaac
gggacctgcgtgtccccgggagtgtgtcagtgtcactttggctttgtgggggacaactgc
tcgtctcagtgtcgctgtaacaaacacagcaactgtaaaggagtgtctgagcctgacaag
tgtctggagtgtaaaaacaacactatgggtgatcactgtgagaagtgtaagcccctgtat
gtggggtcggcggtgggtggggggacgtgtcgcccctgtcgggagttctgcagggggaac
agcgcagtgtgtctgtcccgggacgaacacaagagggcgctagaccacccccaagaccac
cctctggacccagacagcattgttcagtgggtgtcggagggtcctacagaggactcagcg
gtttgtgtgagctgccagaacaacagcgtgggggacaagtgtgagagctgcctcagcggc
tacttcctactgcaggggaactgtgacaagtgtcagtgtaacggccatgcagacacgtgt
aatgaacatgacggcacaggctgcccatgtcagaacaacacagagacctcttcctgcctc
agcagcccgcagagcgacaggaaggactgctacagaacacagtgcgccaagtgcaaagac
tccttcaacggcacaccggtgaacgggcgccagtgctaccggcagttcaacgtggacaat
gagtgctgcttcgaccccacctctcagacaaactgcttccacgaccccaccatccgcaat
ctgcccaagggacgcaccgtcttcttcgctgcccagccaaagttcaccaacgtggacatc
cgggtcaccatcgacgtgacctttggggaggtggaagtgtacgtgtccaactcccatgac
accttcatcgtagaagtggacctccacacaggcatccacgccatcaagatcgaggatgag
tcg

KEGG   Salmo salar (Atlantic salmon): 106605723
Entry
106605723         CDS       T04363                                 

Definition
(RefSeq) multiple epidermal growth factor-like domains protein 8
  KO
K23664  multipile epidermal growth factor-like domains protein 8
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106605723
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Laminin domain-containing proteins
  Laminin EGF-like domain-containing proteins
   106605723
SSDB
Motif
Pfam: Kelch_3 Kelch_4 Kelch_5 Kelch_6 CUB Kelch_1 Kelch_2 PSI EGF_CA EGF_3 Laminin_EGF EGF PSI_integrin
Other DBs
NCBI-GeneID: 106605723
NCBI-ProteinID: XP_014057101
UniProt: A0A1S3RXZ0
LinkDB
Position
ssa05
AA seq 1645 aa
MASFLHVPLLGLLLVAVAPGCWAGDCKGHRQVLRGPPGYVTDGPGNYSVNGNCEWLIKAP
SSNYRIVLNFTFMETECTYDYLFVYDGDSYQSPLLASLSGTTLPQPIEAKSGKMLLHLFS
DANYNLLGFNATYSFSVCPGACGCHGRCDMASSLCQCHLGWGGADCSTPLCPQACILHGT
CDKRGERCLCSSDFLGQSCQLGLRDDSGVGQWWQVSGSDPYTPPRTGSAGVYLSSTGAMY
LFGGFDLNRALGDLVKYNFSLNQWENRSYGHSPAARHSHTAVEWIGNMVIFGGELASGTL
ASDVWMYRPIQDDWQQLGQSHSPGAPRVANHAAAVVDNYLYIFGGRTEEDMFSSSLYRFA
LRGSGVWEAVQPTGGKPPATAGHSMVFHLPSRALLVYGGHRPTTARFSVRVNSTDVFHVD
RRFWTSFRSRFPATGPRERAFHSATIIGNYMVVYGGNVHIHYQEEKCYDEEIFFYHLGCH
QWVSAGESLQHRGEAVRGRYSHVAAVMEGRVLLVAGGYSGIARGDLVAYKVPLFVSSDPG
DRVSQEDAVCAEAPDESVCLKNPECSWCEGRCREYQPTNPCGSTGCLGLARFLSDCQSCL
VFSGAPGSLPRAPGDFGWCVQNESCLPVSDQSACRVDQISGAYGWWGERTRFLTSLLSCR
TENYVPGLHLLTFQHPRNDSQPDKVSILRSTSIILSPTTEMDVTLQFRGFIHPLWGAPPP
APPPTETVSMWARIQRLHFEARMAAGSNSLKLKEVVGRWAAHQEKETKLLSRPDMGRLFP
NLTRGNRYLVQAEGYLNNSGSGQTSEMALTWNRTALPGGSEISFLFLEPYRSGSCSGYQS
CLACLSDQSCGWCPSLGRCLFRALPDLEPCPEDQGGGERHLLLAPPQCTLCEEYRDCSAC
TQDPYCEWQINSSKKGDYQCSRRGRLDGSIRDPGGCPKVCNQRRTCGECLSNSSQCAWCE
SAQACFYFAAYLTKYPYGECRDWYDSVHSVPQCKQCSALVTCTDCLQTFQCGWCGDYNNP
TIGRCLRGDWGGMDDPSVYNCSVAVDEVRATSPEPQTLAPPRPMEMEMELEHLEEGERDP
VWSYPTCPDVEECRLGLHSCHPFATCVNTPTSFECHCERGYTGDGTLHCNQTPLLGYCHN
QTGQCYCTHHTQGPHCESCLPGYYGDPRNNGTCFRQCQGRSVILSHQSPLSELPISSSLG
WRGGVGGKGGLSHCLWVLSVSENLAPCVPGELCPPVALTLHPDSYTQCTSSYVYVFDGLP
RFLSNGVVHSDHNLIGAFCGATRTQPITVEATSGVISVYFEANVSSDRPQGFNASFWVRR
CRQGSEAGEDGSPVCQGGAQCSGGLCQCTPGYGGPYCDRPLCPGGCGLAEGRGSCNLSLG
VCVCADGWGGSDCATPLDSSSLVWETLLDTQLTANQAHRFLHRMGHSLVSGPQGNLWMYG
GLSLSEGILGNVYRYSVLERRWTQMLTSSVEEGSTPSPRYHHASALLASHEPLSDAQGAT
HNLMLVVGGVTQKGVAMDTWSLNLSSLVWRQHKSSVLPPVAGHTLTVRRDTSMLLIGGYS
PENGFNHHLLEFNIHSGNWTVTPHTGTPPTGLYGHSAVYHEQTDAVYVFGGYRFHVETVE
PSGELYSLYYANLTWSLLVPSQGNK
NT seq 4935 nt   +upstreamnt  +downstreamnt
atggcctccttcctccatgtccccctgctggggttgctgctggtggctgtggcccctggg
tgttgggcaggagactgtaagggccaccgacaggtgctcaggggccccccagggtacgtc
actgacgggccagggaactactctgtaaacgggaactgcgagtggctcatcaaagccccc
agcagcaattaccgtatcgtcctgaacttcaccttcatggagacagaatgcacctacgat
tacctgttcgtctacgatggagactcctaccagagccccctactggccagtctgagtggc
accaccctgccgcagcccatagaagccaagtctggcaagatgctgctccacctcttcagc
gatgccaactacaacctcctgggctttaatgccacctactcattctctgtgtgccctggg
gcctgcggatgtcacgggcgctgtgacatggcctcgtccctgtgccagtgccacctgggc
tggggaggagccgactgcagcacccctctatgtccccaggcctgcatcctgcacggcacc
tgtgacaagagaggagagcgttgtctatgcagctcagacttcctgggccagagctgtcag
ctgggtctccgtgatgacagtggggtggggcagtggtggcaagtgagtgggagtgacccc
tacacgcccccccggacaggctctgctggggtctacctgtcctccactggagccatgtac
ctgtttggagggtttgacttgaaccgagctttgggggacctggttaaatacaacttcagc
ttgaaccaatgggagaacagatcttatggacactccccagcggctcgtcactcccacacg
gcagtagagtggatagggaacatggtgatcttcggaggagagctcgcgagcggcacttta
gccagcgacgtctggatgtaccgcccaatccaggatgactggcagcagctcggccaatcc
cattcgcccggggcaccgagagtggccaaccatgcagcagctgtagtggacaactatctc
tacatatttggcggtcgtacggaagaggatatgttctcatcatctctgtatcggtttgct
ctgcgggggtctggggtgtgggaagcggtgcagcccaccggggggaagccccccgccaca
gcaggccactccatggtgttccacctcccgtcccgggccctgctggtttacgggggccac
aggcctaccaccgccaggttcagtgtacgtgtgaactccacagatgtattccacgtggac
cggaggttctggacctcgttccgttcccgtttcccagccacaggccccagggagagagcc
ttccactcagccaccatcatcggcaactacatggtggtctatggggggaatgtgcacatc
cactaccaggaggagaagtgttatgatgaggaaatcttcttctaccacctggggtgtcat
cagtgggtgtctgctggggagagcctccaacacagaggagaggctgtgagagggcggtac
tcccatgtagctgctgtgatggagggcagggtgctgctggttgccgggggttacagtggt
attgcccgtggagacctggtggcatacaaagttccgctgttcgtgagcagcgacccagga
gaccgggtgagtcaagaagacgctgtgtgtgccgaggcaccagacgagagcgtgtgtctg
aagaacccagaatgcagctggtgtgagggccgctgtcgggagtaccaacccaccaacccg
tgtggcagcacagggtgcctgggcctggcccgcttcctgtctgactgccagtcctgcctg
gtgttcagtggggctccaggttccctgccccgcgcccccggtgacttcggctggtgtgtc
cagaacgagtcctgcctaccggtgtcagatcaaagtgcttgccgtgtggaccagatctca
ggggcgtacggctggtggggggagcgcacccgtttcctcacctccctcctttcctgtcgc
actgagaactatgtcccgggactgcacctgctcaccttccagcacccccgcaatgattcc
cagcctgacaaggtgtccatcctgcgcagcacctccatcatcctcagccccaccacagag
atggacgtcaccctgcagttccgaggcttcatccaccccctgtggggcgcccctccacct
gccccccctcccaccgagacagtctcaatgtgggcccggatacagaggctacactttgag
gcccgcatggccgctggatccaactccctgaaactgaaggaggtggtaggtcgctgggca
gctcaccaggagaaggagacgaagctgctgtcccgtcctgacatgggtcgtctgtttccc
aacctgacccgagggaaccgctacctggtccaggccgagggatacctcaacaactcaggc
tctggacagactagtgagatggccctgacctggaacagaaccgccctgcccggtggaagt
gagatttccttcctgttcttggagccgtaccgttctggctcttgctcggggtaccagtct
tgcttggcgtgtctgtcagaccagtcctgtggctggtgcccgtctctgggccgctgtctg
ttccgtgcactgcctgacctggagccctgcccagaggaccagggaggaggggagcgccac
ctgctgctggccccgccacaatgcaccctctgtgaggagtacagggactgctccgcctgc
actcaggacccctactgtgagtggcagatcaactccagcaagaagggtgattaccaatgc
agccgacggggaagactggatggatccattcgcgacccaggggggtgccctaaagtctgc
aaccagaggaggacttgtggggagtgtctgtctaactccagtcagtgtgcgtggtgtgag
tcggcccaggcctgcttctacttcgctgcctacctcaccaagtatccctacggagagtgc
agggactggtatgacagtgttcactcagtgccccagtgtaagcagtgctcagctctggtc
acctgtacagactgtctccagacgtttcagtgcggctggtgtggagactacaacaacccc
accatcggcaggtgtctacgaggagactggggagggatggacgacccctctgtgtataac
tgcagtgtggctgtggatgaagtacgggctaccagtcctgagccccagaccttggccccc
ccgcggcccatggagatggagatggagctggagcacctggaggagggagagagggaccca
gtctggtcctaccccacctgtcccgatgtggaggagtgcaggctgggcctccacagctgc
caccccttcgccacctgcgtcaacacccccacctcctttgagtgccactgtgagaggggc
tacaccggggacggcaccctgcactgcaaccagacccccctcctgggctactgccacaat
cagacaggccaatgctactgcacacaccacacccagggaccacactgtgaatcctgcttg
cctggatactacggagaccccaggaataatggcacctgtttccgtcagtgtcaggggcgc
tctgtgatcctgtcccaccagtcacccctctctgagctccctatctcgtcctccctgggg
tggcgagggggcgtcggggggaaggggggactttcccactgtctgtgggtcctgtctgtc
tctgagaacctggccccctgtgtgccgggcgagctgtgccctcctgtggctctcaccctg
cacccagactcctacacacagtgcactagctcctacgtttacgtgtttgacggcctgcct
cgtttcttgagcaacggggtggtgcactcggaccacaacctgattggcgcgttctgtggg
gcgacccggactcagccaatcactgtggaggccacttcaggtgtgatctctgtgtacttt
gaggccaacgtctcgtccgaccgtcctcagggtttcaacgcctccttctgggtgcggcgc
tgtcgccagggttctgaggcgggggaggatgggtcacccgtatgccagggaggggcgcag
tgcagcggggggctgtgccagtgtactccggggtatgggggaccgtactgcgacaggccc
ctctgtcccgggggctgtgggctagcagagggccgaggctcctgcaacttgtctctggga
gtgtgtgtgtgtgcagacggttggggcggctctgactgcgccactcctctggactccagc
agtctagtttgggaaaccctactggacacacagctcacagcgaaccaggcccacaggttc
ctccaccggatgggccattctctagtgtctggaccccaggggaacctctggatgtatgga
ggcctctctctctcagagggcatcctgggaaacgtctacaggtactctgtgttggagcgg
cgctggactcagatgctgaccagctcagtggaggaaggctccacccccagcccccgctac
caccatgcctctgcccttctggccagtcacgagcctctctccgacgcccagggagccact
cacaacctcatgctggtggtgggcggtgtcacgcagaagggcgtcgccatggatacgtgg
agcctcaacctcagcagtctggtgtggagacagcacaagagctcagtgctgccaccggtg
gcaggtcatactctaacggtgcgtcgggacacctctatgctgctcatcggaggttactct
ccagagaacggcttcaaccatcacctgctggagttcaacatccactctggcaactggacc
gtcaccccccacaccggcacacctcctacaggtctgtatggccactcggctgtgtaccac
gagcagacggacgccgtgtacgtgttcggaggctaccgcttccacgtggagacagtggag
ccctcaggagagctctacagtctctactatgccaacctcacctggtccctactggtcccc
tcacaggggaataag

DBGET integrated database retrieval system