KEGG   Salmo salar (Atlantic salmon): 106574954Help
Entry
106574954         CDS       T04363                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1-B-like
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106574954
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106574954
Enzymes [BR:sasa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106574954
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106574954
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    106574954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD DUF4537
Motif
Other DBs
NCBI-GeneID: 106574954
NCBI-ProteinID: XP_014006566
UniProt: A0A1S3MUY0
LinkDB All DBs
Position
ssa02
AA seq 1737 aa AA seqDB search
MDNNDGMEVEGWDSGLEEELGVSLEELSKWIEEEVERSEAVRQRKAQLAELKEWVEQKEK
EEEVVDKLFNNANQSIVECEALVKSTYSKMGLVYKESSSEDEGGVGGVQSSDVIEIDDDD
DDDDVIAVGLLVPPKKPGIPVQDAMFKEASAALQRSSQQVLKLAQTVNKNSSSGPAIQQP
GNGTNVQFYMSVIDVYLRVTRWRSLFSVAHDGSVFVCVHTFKEASAALQRSSQQVLKLAQ
TVNKNSSSGPAIQQPGGPVPMPAVFVSQATPRNTPTQPNPSLKDDEIRLEMSLLGKKRTK
TWHSGMLIAINPVGNGYSKYKVKFENKGKSLLSGNHIAFHYHPTLERLYVGARVVAKYKD
GNQVWLYAGIVAEMPNNKNRMRFLIFFDDGYASYVTLPELYPVCRPMKRTWEDIEDASCK
DFIEEYITSYPNRPMVLLKAGQVIKTEWEGTWWRSRVEEVDGSLVKILFLDDKRSEWIYR
GSTRLEPMFNLKTNCANTQEKKMAGQQRTRPSMGALRTKGPVVQYHSGGNTTTPSGTPTK
SPHPLSPPSSIPPTPSQLNQPARTDPKYQMAKKSTSPYIPTPGGSRTGLASNSHAPKAMQ
PQPSTGSPGNSSRMYVLQTGNIQTLTSLQPIQHQQQSLPPPPQAPPTAPAVTPYTISNDR
IPHEPSYRAPTDRIFYLPHTCQPACLNRIRPSRPDMHRGRNPLLTPLLYEFRRMTGRRRV
NRKMSFHVIYKSPCGLCLRSMAEIQRYLFQTRCDFIFLEMFCLDPYVLVDRRFQPQKPYY
YIRDITNGREDIPLSCVNEIDITPPPDVAYSKERIPEDGVFINTSPDFLVGCDCTDGCRD
KSKCSCHQLTLQATACTPGAQINHTAGYTQKRLEECLPTGIYECNKRCKCCSQMCTNRLV
QHGLQVRLQLFKTQNKGWGIRCLDDVAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANL
DHIESVENFKEGYESEAHCSDSDGSGVDMSRLKNPPSSSLALQNKSLPKPPQRTNAANPA
GKARGAGGDSSKDGDSDEESNNDKSSDDTFVKDPYYSSSSVWRSYTTRRQAKGVKEGSQD
SKDGVSVGGKEDRKPPPMPEESGKSKVASWLTNQPSTSQATVKMEGLKIEKKEPGDQKSQ
QSVKTEGGKRQDVMTLSDSDDVQTISSGSDDNKEREKRTQGAVKRQVAVKSTRGIALKNS
HGLMVKTGGAGIGPGGGPGGHGGAQGKGGDGGDSGPKNTRLFFDGEESCYIIDAKLEGNL
GRYLNHSCSANLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKELL
CCCGSTECRGRLLCKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESEAHCSDSD
GSGVDMSRLKNPPSSSMALQNKTLPKPPQRTHAANPAGKARGAGGDSSKDGDSDEESNND
KSSDDTFVKDPYYSSSSVWRSYTTRRQAKGVKEGSQDSKDGMSVSVGGKEDRKPPPMPEE
SGKSKVASWLTNQPSTSQATVKMEGLKIEKKEPGDQKSQQSVKTEGGKRQDVMTLSDSDD
VQTISSGSDDNKEREKRTQGEDGGGAVKRQVAVKSTRGIALKNSHGLMVKTGGAGIGPGG
GPGGHGGAQGKGGDGGDSGPKNTRLFFDGEESCYIIDAKLEGNLGRYLNHSCSANLFVQN
VFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKELLCCCGSTECRGRLL
NT seq 5214 nt NT seq  +upstreamnt  +downstreamnt
atggacaataatgatgggatggaggtggagggctgggactctggtctggaggaggagctg
ggtgtgtctctggaggagctgagtaagtggattgaggaggaggtggagaggagcgaggca
gtccgccagaggaaggcccagctggctgagctcaaagaatgggtggagcagaaagagaag
gaagaggaggtggtggacaaactcttcaacaatgccaaccagtccatagtggagtgtgag
gctctggtgaagtccacctacagtaaaatgggtctggtctacaaggagagctcttcagag
gatgaggggggagtgggaggggttcagtcctctgatgtcatagaaattgacgatgatgat
gacgatgatgatgtcatcgctgtgggcttactggttccacccaagaaacctgggatacct
gtccaggatgcaatgtttaaggaggcgtcggcagctctccagcgttcctcccagcaggtg
ttgaagctggcccagacagtcaacaagaactcttcttctgggcctgctatacaacagcca
ggtaatggcaccaatgtgcaattctatatgtctgtgattgatgtatacctccgggttact
aggtggcgttctctcttcagtgttgcccatgatggcagtgtctttgtgtgtgtacatact
tttaaggaggcgtcggcagctctccagcgttcctcccagcaggtgttgaagctggcccag
acagtcaacaagaactcttcttctgggcctgctatacaacagccaggtggcccagtgccc
atgccagcggtgtttgtgtcccaggccacgcccaggaacacacccacccagcctaacccc
tccctgaaagatgatgaaatcagactggagatgagtcttctgggaaagaagcgcaccaag
acctggcacagcggaatgctcatcgccatcaaccctgtcggtaacggttacagtaagtac
aaggtgaagtttgagaacaaggggaagagtctactgtctgggaaccacatagcgtttcac
tatcaccccactctggagaggctatacgtgggagccagggtggtcgccaagtacaaggac
ggcaaccaggtctggctctacgctggcatcgtggcagagatgcccaacaacaagaaccgc
atgaggttcctgatcttctttgacgacggttatgcctcctacgtgaccctgcctgagctc
taccctgtctgcagaccaatgaagcgtacatgggaggacatagaggatgcatcgtgtaaa
gacttcatagaggagtatataacgtcataccccaacaggcccatggtgctgctgaaggca
ggccaggtcatcaagacagagtgggaggggacgtggtggaggagcagagtggaggaggtg
gacggcagcctcgtcaagatcctcttcctggatgacaagcgtagtgagtggatctatcgt
ggttcaactaggctggagcccatgttcaacctgaagaccaactgtgccaacacccaggag
aagaagatggctggccagcagaggacgcgccccagcatgggagcattgaggaccaagggc
cccgtggtccagtatcacagtggggggaacaccacaacccccagcgggacccccactaaa
tccccccatcccctctccccaccctcctccatccctcctacaccctcccagctcaatcag
cctgcacgaacagatcctaagtatcagatggctaagaagagtacttctccatacattccc
acgccaggaggctctcgcactggattggccagtaatagccacgcccctaaagccatgcag
ccccaaccttcaactggttctcccgggaactcatccagaatgtatgtccttcagactggc
aacatccagactctcacgtccctacagcctatccaacaccagcagcagtctctgccccct
cctccccaagcccctcccaccgcacctgcagtgaccccatacaccatcagtaacgaccgg
attccccacgagccctcgtaccgcgcccccacagaccgcatcttctacctgcctcacacc
tgccagcctgcttgtctcaaccgtatccggccctccagaccagatatgcaccggggcagg
aaccccctgctcacccctctactgtacgagttcagacgcatgacggggcgacggagagtc
aaccgcaagatgtcgttccatgtgatctacaagtctccttgtgggctgtgtctgcgcagc
atggcggagatccagcgctacctgttccagacgcgctgtgacttcatcttcctggagatg
ttctgcttggacccctatgtcctggtcgaccggcgcttccagccccagaagccttactac
tacattcgagacatcaccaacggccgcgaggacattcccctgtcctgcgtcaacgagatc
gacatcacaccgccccccgacgtggcctacagtaaggagcgtatccctgaagacggagtg
ttcatcaacaccagtccagacttcctggtgggctgtgactgtaccgacggctgcagggac
aagtccaagtgttcgtgtcaccagctgaccctgcaggccaccgcctgtacccctggtgca
cagatcaaccacacggctggatacacacaaaagagactggaggagtgtttgcccaccggg
atttatgagtgtaataagcgttgtaagtgctgcagtcagatgtgtactaaccgtctggtg
cagcacggtctgcaggtgaggctgcagctctttaagacccagaacaaaggctggggcatc
cgctgtctggacgacgtggccaagggatccttcgtctgtatctacgccggtaagattctg
acagatgactttgctgacaaggagggtctggagatgggtgatgagtactttgctaacctg
gaccacatagagagtgtggagaacttcaaggaagggtatgagagtgaggcccactgttca
gacagtgacgggagcggggtggacatgtccaggctgaagaaccccccctcgtcctccctg
gctttgcagaacaagagccttcccaaacccccccagagaaccaatgctgccaaccccgct
ggcaaagcgcggggtgctggtggcgactcctctaaggatggggatagtgatgaagagtcg
aacaacgacaaaagttcagacgacacgtttgtgaaggacccctactacagctccagctct
gtgtggaggagctacaccacccgtcgccaggccaagggcgttaaggaagggagccaggac
agtaaggatggtgtgtcagtggggggaaaggaggacaggaagccgccccccatgccagag
gagagtgggaagagtaaagtagcgtcctggctcaccaaccaaccctctacctcccaggcc
accgttaagatggagggactgaagatagagaagaaggagcccggagaccagaaaagtcaa
caatcagtgaagacggagggagggaagagacaggatgtgatgacgctgtcggacagtgat
gacgtccagaccatcagctctggatctgatgacaacaaggagagagagaaacgcacacag
ggtgcggtgaagaggcaggtggctgtgaagtccacacgaggcattgctctgaagaactcc
catggcctgatggtgaagactggaggggctgggatagggccagggggaggcccggggggg
cacggaggggcacagggtaagggtggggacgggggagacagtggacctaaaaacacacgg
ctgttcttcgatggcgaggagtcctgctacatcatcgacgccaagctggagggcaacctg
ggacgctacctcaaccatagctgcagtgctaacctgtttgtccagaatgtgtttgtagac
acacatgatctgcgtttcccctgggtagccttcttcgccagcaagcgtatccgggcgggg
acagagttaacgtgggactataactacgaggttggcagtgtggaggggaaggagctactg
tgctgctgtggctcaacagagtgcagaggaagactgctatgtaagattctgacagatgac
tttgcggacaaggagggtctggagatgggtgatgagtactttgctaacctggaccacata
gagagtgtggagaacttcaaggaagggtatgagagtgaggcccactgttcagacagtgac
gggagcggggtggacatgtccaggctgaaaaaccctccctcgtcctccatggctttgcag
aacaagacccttcccaaacccccccagagaacccatgctgccaaccccgctggcaaagcg
cggggtgctggtggcgactcctctaaggatggggatagtgatgaagagtcgaacaacgac
aaaagttcagacgacacatttgtgaaggacccctactacagctccagctctgtgtggagg
agctacaccacccgtcgccaggccaagggcgtcaaggaagggagccaggacagtaaggat
gggatgagtgtgtcagtggggggaaaggaggacaggaagccgccccccatgccagaggag
agtgggaagagtaaagtagcgtcctggctcaccaaccaaccctctacctcccaggccacc
gttaagatggagggactgaagatagagaagaaggagcccggagaccagaaaagtcaacaa
tcagtgaagacggagggagggaagagacaggatgtgatgacgctgtcggacagtgatgac
gtccagaccatcagctctggatctgatgacaacaaggagagagagaaacgcacacagggt
gaagatgggggaggtgcggtgaagaggcaggtggctgtgaagtccacacgaggcattgct
ctgaagaactcccatggcctgatggtgaagactggaggggctgggatagggccaggggga
ggcccgggggggcacggaggggcacagggtaagggtggggacgggggagacagtggacct
aaaaacacacggctgttcttcgatggcgaggagtcctgctacatcatcgacgccaagctg
gagggaaacctgggacgctacctcaaccatagctgcagtgctaacctgtttgtccagaat
gtgtttgtagacacacatgatctgcgtttcccctgggtagccttcttcgccagcaagcgt
atccgggcggggacagagttaacgtgggactataactacgaggttggcagtgtggagggg
aaggagctactgtgctgctgtggctcaacagagtgcagaggaagactgctataa

DBGET integrated database retrieval system