KEGG   Salmo salar (Atlantic salmon): 106575069
Entry
106575069         CDS       T04363                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106575069
   04115 p53 signaling pathway
    106575069
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106575069
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106575069
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Macro
Other DBs
NCBI-GeneID: 106575069
NCBI-ProteinID: XP_014006697
UniProt: A0A1S3MU44
LinkDB
Position
ssa17
AA seq 104 aa
MGDIAKGKKAFVQKCAQCHTVEDGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGITW
GEATLMAYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggtgacattgcaaagggaaagaaggcctttgttcagaaatgcgcccagtgccacact
gtcgaagacggtgggaagcacaaagtgggtccaaacctttggggtctgttcggacgtaag
actggtcaggctgagggctactcctacacggacgccaacaagagcaaaggcattacttgg
ggtgaagccaccctgatggcgtacttggaaaaccctaagaaatacattccaggaacaaag
atgatctttgctggcatcaagaagaagggcgagcgccaagaccttgttgcatatttgaag
tctgcgacatcgtaa

KEGG   Salmo salar (Atlantic salmon): 106582467
Entry
106582467         CDS       T04363                                 

Gene name
CYC
Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106582467 (CYC)
   04115 p53 signaling pathway
    106582467 (CYC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106582467 (CYC)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106582467 (CYC)
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Other DBs
NCBI-GeneID: 106582467
NCBI-ProteinID: XP_014021090
UniProt: B5DFW1
LinkDB
Position
ssa21
AA seq 104 aa
MGDIEKGKKAFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGFSYTDANKAKGIVW
DTDTLMTYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKSATS
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggtgacattgaaaagggaaagaaggcttttgtccagaagtgtgcccagtgccatact
gttgaaaatggaggaaagcacaaggtcgggccaaacctctggggtctgtttggacgcaag
actggacaggctgaaggcttttcctacacggatgccaacaaagccaaaggcattgtctgg
gacactgataccctcatgacttacttggagaaccccaagaaatacattccaggaacaaag
atgatctttgctggcatcaagaagaagggagaacgtgcagatctcatagcatatttgaag
tctgcaacttcgtag

KEGG   Salmo salar (Atlantic salmon): 106586251
Entry
106586251         CDS       T04363                                 

Gene name
CYC
Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106586251 (CYC)
   04115 p53 signaling pathway
    106586251 (CYC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106586251 (CYC)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106586251 (CYC)
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 106586251
NCBI-ProteinID: XP_014028790
UniProt: B9EMJ0
LinkDB
Position
ssa25
AA seq 104 aa
MGDIAKGKKAFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIIW
ETDTLMTYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKSATS
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggtgatattgctaagggaaagaaggcatttgtccagaagtgtgcccagtgtcatact
gttgaaaatggaggaaagcacaaggtcggtccaaacctctggggtctgtttggacgcaag
actggacaagctgaaggctattcctacacagatgccaacaaatccaaaggcattatctgg
gaaaccgatacactcatgacgtacttggagaaccccaagaaatacattcctggaacaaag
atgatatttgctggcatcaagaagaagggcgagcgtgcagatcttatagcatatttgaag
tcggcaacttcgtag

KEGG   Salmo salar (Atlantic salmon): 106588840
Entry
106588840         CDS       T04363                                 

Definition
(RefSeq) cytochrome c iso-1/iso-2-like
  KO
K08738  cytochrome c
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106588840
   04115 p53 signaling pathway
    106588840
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106588840
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106588840
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 106588840
NCBI-ProteinID: XP_014033791
UniProt: A0A1S3Q1M9
LinkDB
Position
ssa27
AA seq 104 aa
MGDTEKGKKAFVQKCSQCHTVDEGGRHKVGPNLWGLFGRKTGQSPGYSYTQANTNKGVVW
EEKTLMVYLEDPKKYIPGTKMIFAGIKKKKEREDLIAYLKDATS
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggggacacagagaaagggaagaaggcttttgtccagaagtgttcccagtgccacacg
gtggatgaggggggacgacacaaggtgggacctaacctctggggcctgtttggccggaag
acaggacagtcacctggatactcctacacacaggccaacaccaacaagggtgtagtctgg
gaggagaagacactaatggtctatctagaggaccctaagaagtacatcccaggtaccaag
atgatctttgctggtatcaagaagaagaaagagagagaggacctgatagcctacttaaag
gatgccacttcgtag

DBGET integrated database retrieval system