KEGG   Salmo salar (Atlantic salmon): 106576341
Entry
106576341         CDS       T04363                                 

Definition
(RefSeq) uncharacterized LOC106576341
  KO
K05461  KIT ligand
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106576341
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106576341
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106576341
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106576341
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 106576341
NCBI-ProteinID: XP_014008940
UniProt: A0A1S3N0V0
LinkDB
Position
ssa17
AA seq 200 aa
MKSKIRTTTCVLLFLFTSLGVCSGGFGNPVTDDVSRLMLLKHNIPKGYNISIHYLPKERS
GVCWVLLNIYPLEQSLRELARVFGAISSNKDNIMIFITMLQNLRFQFDHEELEATMQVFK
CHYRAVKWPSGLYFDYIRDILNSATHQEGGFRCVPPPCPAPTTPGSEAQDHEQTRSRGSL
LSLLPIPVTACVFLIVWVVS
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaagagcaaaattcggacgaccacgtgtgtcctcctatttctattcacaagtcttgga
gtatgctccggaggatttgggaatcctgtaacagatgatgtgagcaggctgatgttattg
aaacacaatattccgaagggttataacatttctatacattatcttcccaaagagaggagt
ggtgtgtgctgggttctactgaatatctatccactggaacaaagccttagggaactggcc
cgggtgtttggtgccatttcttccaacaaagataatattatgatcttcatcaccatgctg
caaaatctacgtttccaatttgatcatgaggagctggaggcaacaatgcaagtctttaaa
tgccactatagggcggtcaaatggccatctgggctgtattttgactatatcagagacatt
ttgaattctgcaactcaccaagaaggaggattccgctgtgtgcctccaccctgccctgcc
cctactacaccaggaagtgaagcacaggaccatgaacagactcggtcaagggggagtctg
ctgtccctgcttccgatcccagtcacagcctgcgtgttcctcattgtgtgggtggtaagt
taa

DBGET integrated database retrieval system