KEGG   Salmo salar (Atlantic salmon): 106576445
Entry
106576445         CDS       T04363                                 

Definition
(RefSeq) apoptotic protease-activating factor 1-like
  KO
K02084  apoptotic protease-activating factor
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106576445
   04115 p53 signaling pathway
    106576445
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106576445
SSDB
Motif
Pfam: APAF1_C NB-ARC WD40 CARD ANAPC4_WD40 Ge1_WD40 CARD_2 Nup160 AAA_16 NACHT WD40_like AAA_22 Utp8
Other DBs
NCBI-GeneID: 106576445
NCBI-ProteinID: XP_014009105
UniProt: A0A1S3N1A5
LinkDB
Position
ssa17
AA seq 840 aa
MAMMEEGARSCLLQSRSSLEQDIRASYLMDHMISDGVLTGDEEDRIRSKPTRKEQAAALL
ELLLRKDNQAYISFYNALVRESYGDLASLLHNSLPLISPEAEKSFSDGGTRYVQAVLSEG
GVPQRPVVFVSRPALVNRVREKLYRLQEPGWVTVFGMAGSGKSVLAAEAVRDHALITECF
PGGVHWLSIGQLDRSDLLVRIQSLCFRLEQQSQEKDPSSSLHRSPGSLEEAKERLRFLML
RRYPRSLLILDDIWDSSVIKAFDIQCRVLLTTRDRSLADCVSGSKSEVAVESGLEEDQAL
EILALYVNGKPQRLPEQARSIVRECKGSPLVVSLIGALLREFPDRWAYYLHTLQQKKFKR
IRKSSSYDYDALDQAMAASIQVLSDEHRELYIDLTVLEKDVKVPAKVLSVLWDLEPEEVE
DVLQDFVNKSLLFRDCHHRPYLYYLHDLQLDFLAEMNRSGLESLHTKVVRQYQQRYSQGP
PTSGDEECLYWFRFLTYHMAKANLTQELCSLMFSLDWVRTKAQIMGPAHLINDYVEYGAI
LDKENSEVRGHFQEFLSLNGHQLEQRPFPDVVQLALSQPDSSEVYRQALLQAQERATRGG
LYLDWMNKSSLKSLSRLVVQPHQGSIYAACFSHDGTKIASCGSSKTLRVFKSTSGEKMLE
IQAHDDEVLCCAFSPDDRLLATCSSDRKVKVWNVECGTLMRMFEEEHEEQVNHCQFTNTR
RRLLLATCSNDKFLNTKLWNINKPSSQNTMFGHLEPVNHCCFSPDDAYLSTSSSDGTLKL
WEVSSANEWKSIDVADMFPEQREQTAVMVKCSTWSADGRTIICAARNAVFVSVEEPALPC
NT seq 2523 nt   +upstreamnt  +downstreamnt
atggcgatgatggaggaaggggcgcggagctgcctgcttcagtcacgctccagcctggag
caggacatcagggcttcctacctgatggatcacatgatcagtgatggcgtgctgacgggg
gacgaggaggacaggatcaggagcaagcccaccaggaaagagcaggcggcggccctgctg
gagctgctcctgaggaaggataaccaggcctacatctccttctacaatgccctggtccgc
gagagctacggagacctggccagcctgctccacaacagcctgcccctgatctcccctgag
gctgagaagagcttctcagatgggggcacccgctatgtccaggcggtgctgagtgagggc
ggcgtgccccagagacccgtggtgtttgtgagccggccagccctggtaaaccgggtcagg
gagaagctctaccgcttgcaggagcccggctgggttactgtgttcggcatggccggctcc
ggcaagtcagtcttggctgcggaggcagtccgagaccacgcactcatcacagagtgtttt
ccaggaggagtccactggctgtccataggccagctggaccggtctgacctgctggttagg
atccagtcactgtgtttccgcctggagcagcagagccaggagaaagacccctcgtcctcc
ctccaccggtctcctggctctctggaggaggccaaggagcgactacgcttcctcatgctc
cgtcgttaccccaggtcgttgctgatactggatgacatctgggacagctctgtgatcaag
gcctttgacatccagtgtcgagtactgctcaccacccgagacagaagcctagccgactgt
gtcagcggttctaagtctgaggtggcagtggagagtggtctggaggaagatcaggccttg
gagatcctcgccctgtatgtcaacgggaaaccccagagactcccagaacaggcccgcagc
attgtccgagagtgcaaaggctcccccttggtggtgtccctaatcggggccctgctgcgg
gagttcccggaccgctgggcctactacctgcacacgctccagcagaagaagttcaagcgt
atccgtaagtcgtcttcgtatgactacgatgcccttgaccaggccatggctgccagcatc
caggtcctgtctgatgaacacagggagctttacattgacctcactgtgctggagaaggac
gtcaaagtacctgccaaggttctgtcggttctgtgggatctagaaccggaggaggtggag
gacgttctccaggactttgtgaacaagtccctactgttccgtgactgtcaccaccggccc
tacctctactacctccacgacctccagctggacttcctggctgagatgaaccgctctggt
ctagaaagcctccacaccaaggtggtgcgtcagtaccagcagcgctacagccagggtccc
cccacctcaggagatgaagagtgcctctactggttcagattcctcacctaccacatggcc
aaggccaacctcacacaggagttgtgctctctgatgttctctctggactgggtcagaact
aaagctcagattatgggaccggctcatctcatcaatgactatgtggagtacggcgccata
ctggacaaagagaacagcgaggtgcggggccacttccaggagttcctgtctctgaacggc
caccagttggagcagcgtccgttccctgacgtagtgcagctggccctgtcccagccagac
tcctctgaggtgtaccgccaggccctgctgcaggcgcaggagagggccaccagaggggga
ctctaccttgactggatgaacaaaagtagtctgaagagcctgtctcgtctggtggtccag
ccccaccaggggtccatctacgctgcctgcttctcccacgacggcaccaagatcgcctcc
tgtggctccagcaagacactgcgagtgtttaagagcacctctggggagaagatgctggag
atccaagcccacgacgatgaggtgctctgctgcgccttctccccagatgaccgtctccta
gcaacctgctctagtgataggaaggtcaaggtttggaacgtggagtgtgggactctgatg
aggatgtttgaggaggaacacgaggagcaggtcaaccactgtcagttcaccaacacacgt
cgacgcctcctactggccacctgttccaacgacaagttcttgaacaccaagctgtggaac
atcaataaaccctcctcccagaacaccatgtttggtcatttggagcctgtcaatcactgc
tgtttctcccctgatgatgcctacctctccacctcttccagcgacggaaccctgaagctg
tgggaggtgtcctcagccaatgagtggaagtccatagacgtggcggacatgttcccggag
cagagagagcagactgcggtcatggtgaagtgcagcacctggtcagcagacggcaggacc
atcatctgtgctgccaggaacgcggtctttgtgagtgttgaagagccagccctcccctgc
tga

KEGG   Salmo salar (Atlantic salmon): 106609566
Entry
106609566         CDS       T04363                                 

Definition
(RefSeq) apoptotic protease-activating factor 1-like
  KO
K02084  apoptotic protease-activating factor
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106609566
   04115 p53 signaling pathway
    106609566
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106609566
SSDB
Motif
Pfam: WD40 APAF1_C NB-ARC ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like CARD_2 AAA_16 NACHT Utp8 DUF3944 AAA_22
Other DBs
NCBI-GeneID: 106609566
NCBI-ProteinID: XP_014063984
UniProt: A0A1S3SI21
LinkDB
Position
ssa07
AA seq 1265 aa
MAMMEEGARSCLLQSRSSLEQDIRASYLMDHMISDGVLTGDEEDRIRSKPTRREQAAALL
ELLLRKDNQAYISFYNALVRESYGDLASLLHNSLPLVSPEAEKSFSDGGTRYVQAVLSEG
GVPQRPVVFVSRPALVNRVREKLYRLQKEPGWVTVFGMAGSGKSVLAAEAVRDHALITEC
FPGGVHWLSIGQLDRADLLVRIQSLCFRLEQQSQEKDPSSSLHRPPGSLEEAKERLRFLM
LRRYPRSLLILDDIWDSSVLRAFDIQCRVMLTTRDRSLADCVSGFKSEVAVESGLEEDQA
LEILALYVNRKPQRLPEQARSIVRECKGSPLVVSLIGALLREFPDRWAYYLHTLQQKKFK
RIRKSSSYDYDALDQAMAASIQVLSEEHRELYIDLTVLEKDVKVPAKVLSVLWDLEPEEV
EDVLQDFVNKSLLFRDCHHRPYLYYLHDLQLDFLAEMNRSDLESLHTKVVRQYQQRYSQG
PPTSGDEECLYWFRFLTYHMAKANLTQELYSLMFSLDWVRTKAQIMGPAHLINDYVEYGA
ILDKENSEVRGHFQEFLSLNGHQLEQRPFPDVVQLALSQPDSSEVYRQALLQAQERATRG
GLYLDWMNKSSLKSLSRLVVQPHQGSIYAACFSHDGTKIASCGSSKTLRVFKSTSGEKLL
EIQAHDDEVLCCAFSPDDRLLATCSSDRKVKVWNVERGTLMRMFEEEHEEQVNHCQFTNT
RRRLLLATCSNDKFMNTKLWNINKPSSQNTMFGHLEPVNHCCFSPDDTYLSTSSSDGTLK
LWEVSSANEWKSIDVADMFPEQREQTAVMVKCSTWSADGRTIICAARNAVFVFDVETAAM
LLEIRTSRLSTVQYCHSCPSSNLVAIALSHYAVELWDIETSKKMADCSGHLSWVHGVQFS
PDGSLLLSCSDDQTVRVWETNRVHTSSAVCLKRDSDVLFNNGDITVVAADNRNRLQVRNG
RTGAVVFQSEDQTSRIRCTAICSQTSAVGLGREDGTIQVLEVPSGTSLATLQGHTRTVLH
CQFTPEGHTLITSSEDTTIRVWRWRTGECVVLEGHKEQVRCFSLLTTSPSETHLLSWSFD
GTIKVWDMSSGERLQDLVCHQGAVLACDVSPDGQLFATTSADKTAKVWTSASWECVRLLN
GHQDCVRSCKFSWDGRRLATGDDNGEIRLWNMKDGTLLKICSSDNKDAMDSLHGGWVTDL
HFSPDNTVLLSTGGYIKWWNVEKGEALQTFYPTGANLKRIHVSPDFSTFVTIDNIGILYI
LKKVE
NT seq 3798 nt   +upstreamnt  +downstreamnt
atggcgatgatggaggaaggggcgcggagctgcctgcttcagtcacgctccagcctggag
caggacatcagggcttcctacctgatggatcacatgatcagtgacggcgtgctgacaggg
gatgaggaggacaggatcaggagcaagcccaccaggagagagcaggcggcggccctgctg
gagctgctcctgaggaaggataaccaggcctacatctccttctacaacgccctggtccgc
gagagctatggagacctggccagcctgctccacaacagcctgcccctggtctcccctgag
gctgagaagagcttctcagacgggggcacccgctatgtccaggcggtgctgagtgagggc
ggcgtgccccagagacccgtggtgtttgtgagccggccagccctggtgaaccgggtcagg
gagaagctctaccgcttgcagaaggagcccggctgggtcactgtgttcggcatggccggc
tccggcaagtctgtcctggctgcggaggcagtccgagaccacgcactcatcacagagtgt
tttccaggaggagtccactggctgtccataggccagctggaccgggctgacctactggtt
aggatccagtcactgtgtttccgcctggagcagcagagccaggagaaagacccctcgtcc
tccctccaccggcctcctggctctctggaggaagccaaggagcgactacgcttcctcatg
ctccgtcgttaccccaggtcgttgctgatactggatgacatctgggacagctcggtgctc
agggcctttgacatccagtgtcgagttatgctcaccacccgagacagaagcctagccgac
tgtgtcagtggttttaagtctgaggtggcagtggagagtggtctggaggaagatcaggcc
ttggagatcctcgccctgtatgtcaacaggaaaccccagagactcccagaacaggcccgc
agcattgtccgagagtgcaaaggctcccccttggtggtgtccctaatcggggccctgctg
cgggagttcccggaccgctgggcctactacctgcacacgctccagcagaagaagttcaag
cgtattcgtaagtcgtcttcgtatgactacgatgcccttgaccaggccatggctgccagc
atccaggtcctgtctgaggaacacagggagctgtacattgacctcaccgtgctggagaag
gacgtcaaagtacctgccaaggttctgtcggttctgtgggatctagaaccggaggaggta
gaggacgttctccaggactttgtgaacaagtccctactgttccgtgactgtcaccaccgg
ccctacctctactacctccacgacctccagctggacttcctggctgagatgaaccgctct
gatctagagagcctccacaccaaggtggtgcgtcagtaccagcagcgctacagccagggt
ccccccacctcaggagatgaagagtgcctctactggttcagattcctcacctaccacatg
gccaaggccaacctcacacaggagttgtactctctgatgttctctctggactgggtcaga
actaaagctcagattatgggaccggctcatctcatcaatgactatgtggagtacggcgcc
atactggacaaagagaacagcgaggtgcggggccacttccaggagttcctgtctctgaac
ggccaccagttggagcagcgtccgttccctgacgtagtgcagctggccctgtcccagcca
gactcctctgaggtgtaccgccaggccctgctgcaggcgcaggagagggccaccagaggg
ggactctaccttgactggatgaacaaaagtagtctgaagagcctgtctcgtctggtggtc
cagccccaccagggatccatctacgctgcctgcttctcccacgacggcaccaagatcgcc
tcctgtggctccagcaagacactgcgagtgtttaagagcacctctggggagaagctgctg
gagatccaggcccacgacgatgaggtgctctgctgcgccttctcccctgatgaccgtctc
ctagcaacctgctccagtgataggaaggtcaaggtttggaacgtggagcgtgggactctg
atgaggatgtttgaggaggaacacgaggagcaggtcaaccactgtcagttcaccaacaca
cgccgacgcctcctactggccacctgttccaacgacaagttcatgaacaccaagctgtgg
aacatcaataaaccctcctcccagaacaccatgtttggtcatttggagcctgtcaatcac
tgctgtttctcccctgatgacacctacctctccacctcttccagcgacggaaccctgaag
ctgtgggaggtgtcctcggccaatgagtggaagtccatagacgtggcggacatgttcccg
gagcagagagagcagactgcggtcatggtgaagtgcagcacctggtcagcagacggcagg
accatcatctgtgctgccaggaacgcggtctttgtgtttgatgtagagacggcggccatg
ttgttggagatccggaccagtcgcctgagcacggtgcagtactgtcactcctgtcccagc
agcaacctggtggccatcgcactgtcacactatgctgtggagctgtgggacatagagacc
agtaagaagatggctgactgtagtggtcatctgagctgggtccatggagtccagttctcc
cctgacggatctctactgctctcctgttctgacgaccagaccgtcagggtgtgggagacc
aatagagtccacacctcctcggctgtctgtctgaagagggactctgacgtgctctttaac
aacggtgacattaccgtggtcgccgccgacaaccgcaacagactgcaggtgaggaatggg
aggaccggagcggtggtgttccagtcagaagaccagacgtctcgtatccgctgcactgct
atctgctcacagacctcagccgtggggctgggacgagaggatgggacgatacaggtgttg
gaggtgccatcggggacctctctagccactcttcagggtcacaccaggacagttctccac
tgccagttcaccccggagggacacacactcatcacctcctctgaggacaccaccatacgg
gtgtggaggtggaggacaggtgagtgtgtggttctggagggccacaaggagcaggtcaga
tgcttctctctgctcaccacctcaccctcagagacacatctcctcagctggtccttcgac
ggcaccatcaaggtgtgggacatgtctagtggtgaacggctgcaggacctagtgtgtcac
cagggggcggtgctagcctgtgacgtgtcgcctgacggacagctctttgccaccacctcc
gctgacaagactgctaaggtgtggaccagtgcatcgtgggagtgcgtgcgcctgttgaat
ggccaccaggactgtgtccgcagctgcaaattctcttgggacggccgtcgcctagcaacc
ggcgacgacaacggagagatacggctgtggaacatgaaggatggtactctgctaaagatc
tgttccagtgacaacaaagacgccatggactctctgcacggaggctgggtgaccgacctg
cacttctccccagacaacactgtgctgctgtctacaggaggatacattaagtggtggaac
gtggagaaaggggaggccctccagaccttctacccgacaggagccaatctgaaaaggatc
catgtgtcacctgacttctccaccttcgtcaccatagacaatatcggaatcctctacatc
ctgaagaaggtggaatga

DBGET integrated database retrieval system