KEGG   Salmo salar (Atlantic salmon): 106576717
Entry
106576717         CDS       T04363                                 

Gene name
aifm2
Definition
(RefSeq) apoptosis inducing factor, mitochondria associated 2
  KO
K22745  apoptosis-inducing factor 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106576717 (aifm2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DAO GIDA AlaDh_PNT_C FAD_oxidored TrkA_N NAD_binding_8 Lycopene_cycl K_oxygenase Thi4 FAD_binding_3 NAD_binding_7 FAD_binding_2 Amino_oxidase 3HCDH_N
Other DBs
NCBI-GeneID: 106576717
NCBI-ProteinID: XP_014009531
UniProt: A0A1S3N3C5
LinkDB
Position
ssa18
AA seq 371 aa
MGSQISVDNVHVVVVGGGFGGTAAAQQLKSRGIPFTLIDLRDAFHHNVAALRASVQSGFA
QQTFIPYFKTFGENFLQGRVVRVDPVSQTVALDGGKEVHYSHLILCTGTDGPFPGKYNMV
ASYQTAIQKYEDIVKEVQAAGSVLVVGGGSTGVEMAAEIKTEYPDKKVILIHSHVGLADP
ELLPSVRQQAKEVLLEKGVELLLGQKVSNLSILELNVTNKNMVIVTDKDTEITADLVICC
TGMKINSDAYSSTLNGCLAENGSLKVNAHLQVEGYDNVYAVGDCANVNEPKMAYHAGLHA
GVAVTNITNSLMGKPLESYHPGSVTMLLAMGHNDGVGQFNGLRLPRCLVTQGKSKNLLLW
KSWKEMGQKAP
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgggcagccagatatctgtagacaatgttcatgttgtggtggttggtgggggtttcggt
ggcaccgccgccgcacaacagctcaaatccagggggataccattcaccctcattgacctc
cgtgacgcctttcatcacaatgtggctgccctccgtgcctctgttcagagtggctttgcc
cagcagaccttcatcccatattttaagacatttggagagaatttccttcaggggcgagtc
gtacgggtggacccagtgtcacagactgtagcgttggatggaggaaaggaagttcattac
tcgcaccttatactgtgcactggcacagacggccctttcccggggaagtacaacatggtg
gcctcctatcagacagccatccagaagtatgaggacattgtgaaggaggtccaggccgca
ggttcggttcttgtggtaggcggtggatccactggtgtagagatggctgcagagatcaaa
acagaatatccagacaagaaggtgatcctgatccattcccatgttggcctagccgaccca
gagctgctgcccagtgtcagacaacaggctaaggaggtgctgctggagaaaggagtggag
ctgctactggggcagaaagtttctaacctgtctatactggagctcaatgtgaccaacaag
aacatggttatcgtgacagacaaggatacagagatcactgcagacctggtcatctgctgc
acaggcatgaagattaactctgatgcctatagctccactctgaatggatgcctagcagag
aatgggtccctgaaagtgaatgcgcacctgcaggtggagggctatgacaatgtgtacgct
gttggggactgtgctaatgttaacgagcctaagatggcgtatcatgcaggtctccacgcc
ggggttgctgttaccaacatcaccaacagtctgatggggaaacccctggaatcttatcac
ccagggagtgtgaccatgttgttagccatgggccataacgatggagtgggccagttcaat
gggctgaggcttccccgttgccttgtaactcagggcaagagcaagaacctactgctgtgg
aaaagctggaaggaaatgggtcagaaagctccttaa

DBGET integrated database retrieval system