KEGG   Salmo salar (Atlantic salmon): 106576854
Entry
106576854         CDS       T04363                                 

Definition
(RefSeq) suppressor of fused homolog
  KO
K06229  suppressor of fused
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106576854
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 106576854
NCBI-ProteinID: XP_014009806
UniProt: A0A1S3N438
LinkDB
Position
ssa18
AA seq 472 aa
MDEVRPNNGPAVAPGLASIFPPGLQAIYGECRRLYPDQANPLQVTAIVKYWLGGPDPLDY
ISMYRNVGCAAQDVQEHWHYISFGLSDLYGDNRVHEFTGQEGPSGFGFELTFRLKREVGE
TAPPTWPAELMQGLARYVFQSENTFCSGDHISWHSPLDNSESRIQHMLLTEDPQISPVHT
PFGLVNFLQIVGVCTEELQAAQQWNGQGILELLRGVHVAGGPWLITDMRRGETMFDIDPH
LQQERVDQGIETEGSNLSGVSAKCVWDDLSRPSEDEEDSRSICIGSQPRRLSEKDTEQIR
EALRKGLEFNTKAALPPINSQKQGHDRPQSRKDSLESESSAAIIPHELVRTRQLESVHLK
FNQESGTLLPLCLRGRLLHGRHFTYKSINGDTAITFVSTGVEGAFATEEHPYAAHGPWLQ
ILLTEEFVEQMLGDLSELNTREETKLPKEYSWPEKKLKISVLPDSVFDNPLQ
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggacgaggtgcggcctaacaacggaccagcagtagcccctgggctggcgtcaatcttc
cccccgggtctgcaggcaatctacggggaatgcaggcgcctctaccccgaccaggccaac
cccttacaagttacagccattgtcaaatactggttagggggtcctgatccattggactac
atcagtatgtaccgtaacgtgggctgtgcagcgcaggatgtacaggagcactggcactac
atcagcttcggactcagtgacctgtatggagacaacagagtacatgagtttacaggtcag
gaaggccccagtggctttggatttgagctgacgttcaggctgaagagagaggtgggagag
actgcaccccctacctggccggctgaactcatgcagggcctggcccgctacgtcttccaa
tcagaaaacacattttgcagtggagaccacatatcgtggcacagtcccctggacaacagt
gagtctcgtatccaacacatgctgctcactgaggacccccagatatcgccggtccacaca
cccttcggcctggtcaacttcctgcagattgtgggtgtgtgtacagaagagttgcaggcg
gcccaacagtggaacggccagggaatactggagcttctccgaggggtccatgttgccgga
ggaccctggttgataactgacatgaggagaggagagaccatgtttgacatcgacccgcat
ttacaacaggagcgtgtggaccagggtatagagacagagggatccaacttgagtggcgtg
agcgcaaagtgtgtgtgggacgacctcagccggccttccgaggatgaagaggacagccgc
tccatctgtataggatctcagccacgaagactgtcggagaaagatacagagcagatcaga
gaagccctgaggaaaggactggagttcaacactaaagcagcactaccccctatcaactca
cagaaacaaggacacgacaggcctcaaagtcgtaaggacagtctggagagtgagagttca
gcggccatcattcctcacgagctagttcgtaccagacaactggaaagtgttcatctgaaa
ttcaaccaggagtcaggaacactgctgcccctctgtctcaggggtcgtttgctccatggt
agacacttcacctataagagtattaatggagacacagccatcaccttcgtatccactgga
gtagagggggcctttgctactgaggaacacccgtacgccgcacatggaccctggctacag
atattgctgactgaagagtttgttgaacagatgcttggagacctatcggagctcaacact
cgagaggagaccaagttaccgaaggaatatagctggccagagaagaaactgaagatctcg
gtcctgcctgactctgtgtttgacaaccctctgcagtga

KEGG   Salmo salar (Atlantic salmon): 106604342
Entry
106604342         CDS       T04363                                 

Definition
(RefSeq) suppressor of fused homolog
  KO
K06229  suppressor of fused
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106604342
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 106604342
NCBI-ProteinID: XP_014054356
UniProt: A0A1S3RPU6
LinkDB
Position
ssa01
AA seq 499 aa
MRKTFHRYSQLSEAVGMDEVRPTSGPVAPGLASLFPPGLQAIYGECRRLYPDQANPLQVT
AIVKYWLGGPDPLDYISMYRNMGCAAQDVQEHWHYISFGLSDLYGDNRVHEFTGQEGSSG
FGFELTFRLKREVGETAPPTWPAELMQGLARYVFQSENTFCSGDHISWHSPLDNSESRIQ
HMLLTEDPQMTPVHTPFGLVNFLQIVGVCTEELQAAQQWNGQGMLELLRGVHVAGGPWLI
TDMRRGETIFDIDPHLQPERVDQGIETEGSNLSGVSAKCVWDDLSRPPEDEEDSRSICIG
SQPRRLSEKDTEQIREALRKGLEFNTKATLPPINSQRQGHDRPQSRKDSLESESSAAIVP
HELVRTRQLESVHLKFNQESGTLLPLCLRGRLLHGRHFTYKSINGDTAITFVSTGVEGAF
ATEEHPYAAHGPWLQILLTEEFVEQMLGDLSELNTREEIILQVKKPDVEVLAGVVTHGLR
LRPVDVLTNFRKRRWRRLW
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgaggaaaacttttcataggtattcccagctttctgaagcagtagggatggacgaggtg
cggcctaccagcggaccagtagcccccggcctggcgtcactcttccccccgggtctgcag
gcaatctacggggaatgcaggcgcctctaccccgaccaggccaaccccttacaagttaca
gccattgtaaaatactggttgggaggtcctgatccattggactacatcagtatgtaccgt
aacatgggctgtgcagcgcaggacgtacaggaacactggcactacatcagcttcggactc
agtgacctgtatggagacaacagagtacatgagtttacaggccaggaaggctccagtggc
tttggctttgagctgacgttcaggctgaagagagaggtgggagaaacagcccctcctact
tggccggctgaactcatgcagggcctggcccgctatgtcttccaatcagaaaacacgttt
tgcagtggagaccacatatcgtggcacagtcccctggacaacagtgagtctcgtatccaa
cacatgctgctcactgaagacccccagatgactccggtccacacccccttcggcctggtc
aacttcctgcagattgtgggtgtgtgtacagaagagttgcaggcggcccagcagtggaac
ggccaaggaatgctggagctgctccgaggggtccatgttgctggagggccctggttgata
actgacatgaggagaggagagaccatctttgacatcgaccctcatttacaaccggagcgt
gtggaccagggtatagagacagagggctccaacctgagcggcgttagcgcaaagtgtgtg
tgggacgacctcagccgaccacccgaggatgaagaggacagccgctccatctgtatagga
tctcagccacgaagactgtcggaaaaagatacagagcagatcagagaagccctgagaaaa
ggattggagttcaacactaaagcgacactaccccctatcaactcacagagacaaggacat
gacaggcctcagagtcgtaaggacagtctggagagtgagagttcagcggccatcgttcct
cacgagctagttcgtaccagacaactggaaagtgttcatctgaaattcaaccaggagtca
ggaacactgctgcccctctgtctcaggggtcgtttgctccatggtagacacttcacctat
aagagtataaatggagacacagccatcaccttcgtatccaccggagtagagggggccttt
gctactgaggaacacccgtacgccgcacatggaccctggctacagatattgctgactgag
gagtttgttgaacagatgcttggagatctatcggagctcaacactcgagaggagatcatc
ctgcaggtaaagaagccagatgtggaggtcctggctggcgtggttacacatggtctgcgg
ttgaggccagtggacgtactgacaaattttcgaaaacgacgttggaggcggctatggtag

DBGET integrated database retrieval system