KEGG   Salmo salar (Atlantic salmon): 106577009
Entry
106577009         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04115  p53 signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04218  Cellular senescence
sasa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106577009
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106577009
   04070 Phosphatidylinositol signaling system
    106577009
   04150 mTOR signaling pathway
    106577009
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106577009
  09143 Cell growth and death
   04115 p53 signaling pathway
    106577009
   04218 Cellular senescence
    106577009
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106577009
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106577009
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106577009
    3.1.3.48  protein-tyrosine-phosphatase
     106577009
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     106577009
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    106577009
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 106577009
NCBI-ProteinID: XP_014010120
UniProt: A0A1S3N465
LinkDB
Position
ssa18
AA seq 444 aa
MAAKIKLMVSRNKRRFQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDEVVRFLDSK
HKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFQDAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKNKLDYKPVALLFHKMVFETLPMFSGGTCRDSTVKNRSEPIPLGFKKGNWHWDPQFVV
YQLKVKIHTSNPAHTRREEKHMLFEFPQPLPVCGDVKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPPEESMEKVENGSVVVNDVDGVQNQSTIGTPPQAPQSAERRDSGRDSDRDYLILA
LTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEDSSNSEASTSTSVTPDVSDNEPDHYRY
SDTTDSDPENEPFDEEQHTQITKV
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggctgcgaagataaaattaatggtcagccggaacaaaaggagattccaggaggatggg
ttcgacttggatttaacgtatatctatccaaacatcattgctatgggctttcctgcagag
cgactcgaaggagtgtacagaaacaatatagacgaggttgtacggtttcttgactcgaaa
cataaaaaccattataagatttacaatctttgtgcagaacgacactacgatgctgccaaa
tttaactgtagagttgcacaatacccctttgaagaccacaacccgcctcagctagagctc
atcaagccgttctgtgaagacctcgaccagtggctgagcgaggatgacaatcatgtggcg
gccatccactgcaaggcagggaaaggccgcaccggggtgatgatctgcgcctacctcctg
caccgtggcaagttccaggacgcccaggaggcactggacttctacggggaagtgcggaca
agggacaagaagggagtgacgatcccaagccaacggcgctatgtgtactactacagccac
ctgctgaaaaacaagctggactacaagcctgtggctctcctcttccacaaaatggtgttt
gagacgctaccaatgttcagtggaggcacctgcagggacagtaccgttaaaaacaggagc
gagccgatccctctgggcttcaagaaagggaattggcattgggatcctcagtttgtggtg
tatcaacttaaagtcaagatccacacatccaacccggctcacacgcggagggaagaaaag
cacatgctatttgagtttccccagccgctgcccgtctgtggagacgtcaaagtggagttc
tttcacaagcaaaacaaaatgatgaagaaggataagatgttccacttctgggttaacacc
ttcttcatccccgggccaccggaggagagcatggagaaggtggagaacgggtcggtggtg
gtgaacgatgtggacggggttcagaaccagtccacgatcggcacacctccccaggccccg
cagagtgccgaacgcagggacagcggcagggacagcgacagggactacctcatcctcgcg
ctcaccaagaatgacctggacaaggccaacaaagacaaagctaaccgctacttctcacct
aatttcaaggtgaagttgtatttcacaaaaaccgtggaagattcttcgaattccgaggcg
agcacttcgacatctgtcactccggacgttagtgacaacgagcctgaccattatcgatat
tccgacaccactgactctgatccggaaaacgaaccttttgatgaggagcagcacacgcag
atcacgaaagtgtga

KEGG   Salmo salar (Atlantic salmon): 106578954
Entry
106578954         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04115  p53 signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04218  Cellular senescence
sasa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106578954
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106578954
   04070 Phosphatidylinositol signaling system
    106578954
   04150 mTOR signaling pathway
    106578954
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106578954
  09143 Cell growth and death
   04115 p53 signaling pathway
    106578954
   04218 Cellular senescence
    106578954
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106578954
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106578954
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106578954
    3.1.3.48  protein-tyrosine-phosphatase
     106578954
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     106578954
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    106578954
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 106578954
NCBI-ProteinID: XP_014013740
UniProt: A0A1S3NES8
LinkDB
Position
ssa19
AA seq 433 aa
MAAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKNQLDYKPVALLFHKMVFETVPMFSGGTCRDTSVKNKSEQIPHGFRKGNWHWDPQFVV
YQLKVKIHTSNPVNTRKEEKYVFFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFVPGPEENFEKVENGTLPTETLPKEQAGIQTGGTGDIDKDFLILSLTKNDLDKANKDKA
NRYFSPNFKVSQVKLYFTKTVEDIFNSEASTSTSLTPDVSDNEADHYRYSDTTDSDPENE
PFDEDQHTQITKV
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggctgcaatcataaaggaaattgtcagccgaaacaaaaggagataccaggaggatggg
tttgacttggacttgacttatatttatccgaacataattgctatgggctttcctgctgaa
agacttgagggtgtctacagaaacaacattgatgatgtagtacggtttctggactctaag
cacaaaaatcattacaagatctataatctgtgcgctgagcgacattatgacacagccaaa
ttcaattgcagagttgcacaatatccgtttgaggatcacaatccgccccagctggagctg
attaaaccgttctgcgaagatcttgaccagtggttaagtgaggatgacaatcacgtggcg
gcgattcactgtaaagctggaaagggacgtacgggtgtcatgatctgtgcatacctgtta
caccggggaaagttcctcaaagcacaagaagctctggacttctatggggaagtcaggacc
agagataagaagggagtgacaatccccagccagaggcgctatgtctattactatagccac
cttctgaagaaccagctggattacaaaccagtggctctgctcttccacaagatggtgttc
gagacagtgcccatgttcagtggcggaacgtgtcgggacacttccgttaaaaacaagagc
gagcagattccacatggtttcaggaaagggaattggcactgggatcctcagtttgtggtg
taccagctcaaggtaaagatccacacgtccaacccggtgaacacgcggaaggaggagaag
tacgtgttcttcgagttcccccagccgctgcccgtgtgcggagacatcaaggtggagttc
ttccacaaacagaataaaatgatgaagaaggacaagatgtttcacttttgggtgaatacc
ttcttcgtccctggaccagaggagaactttgagaaggttgagaacgggacgttaccaacg
gagacgttaccaaaggagcaggcaggaatccaaacaggaggaacgggggacatcgacaag
gatttcctgatcctctcactgacgaagaacgacctggacaaggccaacaaggataaagca
aaccgatacttctcccccaacttcaaggtcagtcaggtgaagctgtactttaccaagacc
gtggaggacatcttcaactccgaggccagcacttccacctcgctaacgccagacgttagt
gacaacgaggcggaccattaccgatactctgacaccacagactctgacccggagaacgaa
ccgtttgacgaagatcaacacacgcaaataacgaaagtgtga

KEGG   Salmo salar (Atlantic salmon): 106589390
Entry
106589390         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04115  p53 signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04218  Cellular senescence
sasa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106589390
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106589390
   04070 Phosphatidylinositol signaling system
    106589390
   04150 mTOR signaling pathway
    106589390
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106589390
  09143 Cell growth and death
   04115 p53 signaling pathway
    106589390
   04218 Cellular senescence
    106589390
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106589390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106589390
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106589390
    3.1.3.48  protein-tyrosine-phosphatase
     106589390
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     106589390
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    106589390
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 APG12
Other DBs
NCBI-GeneID: 106589390
NCBI-ProteinID: XP_014034772
UniProt: A0A1S3Q4A5
LinkDB
Position
ssa28
AA seq 426 aa
MAAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKHHYKIYNLCAERHYDATKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSENDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQDALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKNQLEYKPVALLFHKMVFETVPMFSGGTCRDTSVKNKSEQIPHGFRKGNWHWDPQFVV
FQLKVKIHTSNPVNTRREEKYVFFELPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPDEKVENGTLPKEQEGIQTTGGTGDNDKECLILSLTKNDLDKANKDKANRYFSPN
FKVSQVKLYFTKTVEDPFNSEASTSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEEQL
TQITKV
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggctgcaatcataaaggaaattgtcagccgaaacaaaaggagataccaggaagatggg
tttgacttggacttgacttatatttatccaaacataattgctatgggctttcctgctgaa
agacttgagggtgtctacagaaacaacatcgatgacgtagtacggtttctggactctaaa
cacaaacatcattacaagatatataatctgtgcgctgagcgacattatgacgcaaccaaa
ttcaattgcagagttgcacaatatccgtttgaggatcacaatccgccccagctggagctg
atcaaaccgttctgcgaagatcttgaccagtggttaagtgaaaacgacaatcatgtggcg
gcgattcactgtaaagctggaaagggacgtacgggtgtcatgatctgtgcttacctgtta
caccggggcaagttcctcaaagcacaagatgctctcgacttctacggcgaagtcaggacc
agagataagaagggagtaacaatccccagtcagaggcggtatgtctactactacagccac
cttctgaagaaccagctggagtacaaaccagtggctctgctgttccacaagatggtgttc
gagacggtgcccatgttcagtggtggaacgtgtagggacacttccgttaaaaacaagagt
gagcagattccacatggtttcagaaaagggaattggcactgggatcctcagtttgtggtg
ttccagctcaaggtaaagatccacacgtccaacccggtgaacacgcggcgggaggagaag
tacgtgttcttcgagttgccccagccgctgcccgtgtgtggagacatcaaggtggagttc
ttccacaaacagaacaaaatgatgaaaaaggacaagatgtttcacttctgggtgaacacc
ttcttcatccctggaccagacgagaaggtggagaacgggacgttaccgaaggagcaggaa
ggaatccaaaccacaggaggaacgggagacaacgacaaggaatgcctgatcctctcactg
acgaagaacgacctggataaggccaacaaggataaagcaaacagatacttctcccccaac
ttcaaggtcagtcaggtgaagctgtactttaccaagactgtggaggaccccttcaactct
gaggccagcacttccacctcggtaacgccagacgttagtgacaacgagcctgaccattac
cgatactctgacaccacagactctgacccagagaatgaaccatttgacgaggagcaactc
acacaaataacaaaagtgtga

KEGG   Salmo salar (Atlantic salmon): 106600774
Entry
106600774         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04115  p53 signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04218  Cellular senescence
sasa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106600774
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106600774
   04070 Phosphatidylinositol signaling system
    106600774
   04150 mTOR signaling pathway
    106600774
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106600774
  09143 Cell growth and death
   04115 p53 signaling pathway
    106600774
   04218 Cellular senescence
    106600774
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106600774
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106600774
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106600774
    3.1.3.48  protein-tyrosine-phosphatase
     106600774
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     106600774
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    106600774
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase CDKN3 Y_phosphatase3
Other DBs
NCBI-GeneID: 106600774
NCBI-ProteinID: XP_014047862
UniProt: A0A1S3R7Q1
LinkDB
Position
ssa03
AA seq 425 aa
MAAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERFEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERQYDAIKFNCIVAQYPFEDHNPPQLELIKLFCEDLDQWLSEDDNHVA
AIHCKAGNGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKNQLDYKPVALLFHKMVFETVPMFSGGTCRDTSIKNKSEQIPHGFRKGNWHWDPQFVV
YQLKVKIHTSNPVNTRKEEKYVFFEFPQPLPVGGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFVPGPEEHFEKVENGTLPKEQAGTQTGGTGDNDKDYLILSLTKNDLDKANKDKANRYFS
PNFKVKLYFTKTVEDIFNSEASTSTSLTPDVSDNEADHYRYSDTTDSDPENEPFDEEQQT
QITKV
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggctgcaatcataaaggaaattgtcagccgaaacaaaaggagataccaggaggatggg
tttgacttggacttgacttatatttatcccaacataattgctatgggctttcctgctgaa
agatttgagggtgtctacagaaacaatatcgatgacgtagtacggtttctggactctaag
cacaaaaatcattacaagatatataatctgtgcgctgagcgacaatatgacgcaatcaaa
tttaattgcatagttgcacaatatccgtttgaggatcacaatcccccccagctggagctg
atcaaactgttctgcgaagatcttgaccagtggttaagtgaggacgacaatcacgtggcg
gcgattcactgtaaagctggaaatggacgtacgggtgtcatgatctgtgcttacctgtta
caccggggcaagttcctcaaagcacaggaagctctggacttctacggtgaagtcaggacc
agagataagaagggagtgacaatccccagccagaggcgctatgtctactattatagtcac
cttctcaagaaccagctggattacaaaccagtggctctgctcttccacaagatggtgttc
gagacggtgcccatgttcagtggcggaacgtgtcgggacacttccattaaaaacaagagt
gagcagattccacatggtttcaggaaagggaattggcactgggatcctcagtttgtcgtg
taccagcttaaggtaaagatccacacgtccaacccggtgaacacgcggaaggaggagaag
tacgtgttcttcgagttcccccagccactgcccgtgggtggagacatcaaggtggagttc
ttccacaaacagaacaagatgatgaagaaggataagatgtttcatttctgggtgaacacc
tttttcgtccctggaccagaggagcactttgagaaggttgagaacgggacgttaccaaag
gagcaggcaggaactcaaacaggaggaacgggggacaacgacaaggattacctgatcctc
tcactgacgaagaacgacctggacaaggccaacaaggataaagcaaacagatacttctcc
cccaacttcaaggtgaagctgtactttaccaagactgtggaggacatcttcaactctgag
gccagcacttccacctcactaacgccagacgttagtgacaacgaggcggaccattaccga
tactctgacaccacagactctgacccggagaacgaaccgtttgatgaggagcaacagacg
caaataacaaaagtgtga

KEGG   Salmo salar (Atlantic salmon): 106607213
Entry
106607213         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04115  p53 signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04218  Cellular senescence
sasa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106607213
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106607213
   04070 Phosphatidylinositol signaling system
    106607213
   04150 mTOR signaling pathway
    106607213
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106607213
  09143 Cell growth and death
   04115 p53 signaling pathway
    106607213
   04218 Cellular senescence
    106607213
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106607213
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106607213
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106607213
    3.1.3.48  protein-tyrosine-phosphatase
     106607213
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     106607213
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    106607213
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 CDKN3
Other DBs
NCBI-GeneID: 106607213
NCBI-ProteinID: XP_014059415
UniProt: A0A1S3S4Y1
LinkDB
Position
ssa01
AA seq 446 aa
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKSHYKIYNLCVERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRSKFQEPQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKNKLDYKPVALLFHKMVFETLPMFSGGTCRDSTIKNRSEPIPLGFKKGNWHWDPQFVV
YQLKVKIHTSNPAHTRREEKHMLFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPSEESMEKVENGSVVVNDMEGVQNQPPGGPPPYAQPPQSAKRRDSSKDSDGDYLI
LALTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEDSLNSEVSTSTSVTPDVSDNEPDHY
RYSDTTDSDPENEPFDEEQHTQITKV
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggctgcgataataaaagaaatggtcagccggaacaaaaggagataccaggaggatggg
ttcgacttggacttaacgtatatctatccaaacatcattgctatgggctttcctgcagaa
cgacttgaaggagtgtacagaaacaatatagacgacgttgtacggtttcttgactcaaaa
cataaaagccattataagatttacaatctttgtgtagaacgacactatgatgctgccaaa
tttaactgcagagttgcacagtacccctttgaagaccacaatccacctcagctagagctc
atcaagccattctgtgaagatctggaccagtggctgagcgaggatgacaatcatgtggcg
gccatccactgcaaggcagggaaggggcgcactggggtgatgatctgcgcctacctcctg
caccgcagcaagttccaagagccccaggaggccctcgacttctatggggaagtgcggaca
agggacaagaagggagtgacaatcccgagccaacggcgctatgtgtactactacagccac
ctgctgaagaacaagctggactacaagccagtggctctgctcttccataaaatggtgttt
gaaacgctgccaatgttcagcggaggcacctgcagggacagtaccattaaaaacaggagc
gagccgatccctctgggtttcaagaaagggaattggcattgggatcctcagtttgtggtg
tatcaacttaaagtcaagatccacacgtccaacccggctcacacacggagggaagaaaag
cacatgctatttgagtttccccaaccgctgcccgtgtgtggagacatcaaagtggagttc
tttcacaagcaaaacaaaatgatgaagaaggataagatgttccacttctgggttaacacc
ttcttcattcccgggccatcggaggagagcatggagaaggtggagaacgggtcggtggtg
gtgaacgacatggaaggggtccagaaccagcccccgggcggcccccctccctatgcccag
cccccccagagcgccaagcgcagggacagcagcaaagacagtgacggggactacctcatc
ctcgcgctgaccaagaatgacctggacaaggccaacaaagacaaagctaaccgctacttc
tcacctaatttcaaggtgaagttgtatttcacaaaaaccgtggaagattctttgaattcc
gaggtgagcacttcgacatccgtcactccggacgttagcgacaatgagcctgaccattat
cgatattccgacaccactgactctgatccggaaaatgaaccttttgacgaggaacagcac
acgcaaatcacaaaagtgtga

DBGET integrated database retrieval system