KEGG   Salmo salar (Atlantic salmon): 106577125
Entry
106577125         CDS       T04363                                 

Definition
(RefSeq) pro-neuregulin-3, membrane-bound isoform-like
  KO
K05457  neuregulin 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106577125
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106577125
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106577125
SSDB
Motif
Pfam: EGF DUF2685 Laminin_EGF
Other DBs
NCBI-GeneID: 106577125
NCBI-ProteinID: XP_014010353
UniProt: A0A1S3N4D0
LinkDB
Position
ssa18
AA seq 703 aa
MSESSGAVTSGAVILEECPEGSGEREQVQAQEPGRLRCGGCTLWPRQQTWLCVVPLLIGF
IGLGLSLMLLKWIVVGSVRDYVPTDLVDAKGIGQDPMFPPHLSKPSALPKNSDTTSTTTT
ATITTLANPTSTTVTAVRGRTRTVVANHPGGTTTTARVGGASGSQVTPRSTTQRQGNSGG
GGPQGPLITTTTVAPVAASTFTTSSPKPSNPTVLHDSTQMWTHEHTTGRPASTPTWTHVN
RKTPSPTIPPLVSEHFKQCHEKDLAYCLNDGECFVIETLSGPHKHCRCREGYQGIRCDQF
LPKTDSILSDPTDHLGIEFMESKEVYKRQVLSITCIAVGISVLGTLCMALYCRNKRRREK
LQAHLKESRSLKNYSANASALESKPGLRPNTGLQLQNYCKRSSQPHEGAVWESSFAQCNA
TPANNSRGPGREKHYRSGSLSHSPDQRSRATHWSVPRRTLPIPRGRINPNGGSKHSGPAY
QHLQELESSEREVESLRGCQLVRAGSEPRQDAFLNMQPPVSVEQSWESRVKVRCCPLDQG
LDHDISTSTWSLRRPRCPSRSSPPPFRTCSIPIIPSVQGHKDEVSCLQTATGSATCSTMP
SKEVGGRSLIILHPTSTSCSSSIGGQQQDKVALLLEEAQEHLRALAHRKQEDSVSAAPQL
PRETVCFLTLNGGAAGGLSPNGPTETQLMSPREPHRDSAQPCQ
NT seq 2112 nt   +upstreamnt  +downstreamnt
atgagcgagagctccggagcagtcacatccggggcggtgatcctggaggagtgtccagag
gggagtggggagcgagagcaggtccaagcccaagaaccagggcgcctgcgctgtggaggc
tgcaccctgtggccccgccagcagacatggctatgtgttgtccctctgctcataggcttc
attggcttgggactaagcctgatgctgctcaaatggattgtggtgggctctgttagggac
tacgtgcccacagacctggtggacgccaagggtataggacaggaccccatgtttcccccc
catctctccaagcccagcgccttgcccaagaactcagacaccaccagtaccaccaccacg
gcaaccattactaccttggccaaccccacctcaaccaccgtcacggcagtgaggggcaga
actcgaactgtcgttgccaaccaccctggtggcaccactactacagccagggtgggtggt
gcatcaggcagccaggttacacctcgcagcaccacacagcgccaaggcaactctgggggt
ggaggaccacaaggcccccttattaccacaaccactgtcgcaccagtcgccgcctccact
tttaccacctccagccctaaaccttctaaccccactgtgctgcacgactccacacaaatg
tggacccacgagcacaccacggggaggcctgcctccactcccacatggacccatgtgaac
cgaaaaacaccatcacccaccattcctccattggtctcagagcatttcaagcaatgtcac
gagaaggacctggcctactgcttgaacgatggagaatgttttgtcatcgagacgctgagt
ggtccacacaaacactgcaggtgtagagaaggctaccagggtatacgctgcgaccagttc
ctgcctaagaccgactccatcttgtctgatccaacagatcacttgggcattgagtttatg
gagagcaaggaggtgtacaagagacaagtgctgtcaatcacctgcatcgccgtggggata
agtgttctgggcacgctctgtatggctctctactgtcggaacaagagacgcagggaaaaa
ctccaggcccacttgaaagagagtcgcagcctgaagaactacagcgccaatgcctctgcc
ctggagtccaaacccggcctgaggcctaacacgggcctgcagctgcagaattattgtaag
aggtcctcccagccacatgagggagctgtctgggagtccagctttgcccagtgcaacgcc
accccagcaaacaactccagaggtccaggcagagaaaaacattacagaagcggctccctg
tctcacagtccagaccagagaagtagagccacccattggtcagtaccgcgtagaactctg
cctatacccaggggaagaataaatccaaatggaggatcaaaacattctggccccgcctac
caacacctccaggagttggagtcgtctgagagggaggttgaatcattgagagggtgccag
cttgtgagggccgggagcgaaccgcgacaggatgcctttctaaatatgcaaccccccgtg
tcggtggagcagtcgtgggagagcagggtgaaggtgcgctgctgtcctctggaccagggc
ctggaccatgacatctccacttccacctggagcctcaggcgtcccagatgtccaagccgc
tcttcccctcctcctttccggacctgctccatccctatcatcccctctgtccagggccac
aaggacgaggtctcctgtttgcaaacagctactggctcagccacctgcagcaccatgccc
agtaaggaagtaggagggcgttccctcatcattctgcaccccacctccacctcctgctcc
tcctctattgggggccagcagcaggacaaggtggcccttctcctagaggaggcccaggag
catctcagggctcttgcccacaggaagcaggaagacagcgtcagcgccgcccctcaactg
cccagagagactgtgtgcttcctgacactcaatggtggagcagcggggggtttgagccct
aatggacccactgagacccagttaatgagccctagagaacctcacagagactcagcccag
ccctgccaatga

KEGG   Salmo salar (Atlantic salmon): 106578362
Entry
106578362         CDS       T04363                                 

Definition
(RefSeq) pro-neuregulin-3, membrane-bound isoform-like
  KO
K05457  neuregulin 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106578362
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106578362
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106578362
SSDB
Motif
Pfam: EGF Laminin_EGF
Other DBs
NCBI-GeneID: 106578362
NCBI-ProteinID: XP_014012553
UniProt: A0A1S3NAQ5
LinkDB
Position
ssa19
AA seq 734 aa
MSEHSVASTLGAMTLEEPGGEQVSPRAPGPLRCGPCAVWHRQQTWLCAVPLVMGFVGLGL
SLMLLKWIVVGSVQDYVPTDLVDAKGIGQDPIFLSEPSAPPKRPDTMTTTTKTTATAFVS
TTSLEADGTVPAPRTQFGLPSNHSVPHLHNWVGSGTRVTGTTTRTTRLPPPGGKEVTPHS
TTVLWVSGTANGRKDKDPPNSRAGPTSKATSTTSTANTTTKALPPTFPPSPPAKPTGHWK
PGRSAKGPATRPHHRYRTLAPTSPSLRSDVFKSCIDDKDLAFCLNEGECSIIETVAGVHR
HCRCKEGYHGLRCDQFVPKTDSILSDPTDELGIKFMESRETYQRKVLSIFSIASGIGFLG
VACMALYRRNKRHREKLRAHFLESRNLRVCSINASGFMSKSSPRPQCGWQLQTCYKSHGS
SPPQGCSSLSAGAPTAAPPLLNRALTKGKSFRSSSLSLSSAQRHQDTHHFRTLPISRGPR
VAVPAYKHLQEVESTEMEAESLRGFDTGRDGGDDCQRSGFQNMQTLSRSAWKKDWREVPY
TRLDRGLKPAPPSLRTRSVPIIPSLQGHDREGGHMDKTRQGVSQGGGLAGPGHKAQGPAS
GSSHTPRHSTTSSSETVLESEARPSHVRPCGAKTALGLGTSPSHMHHGSSETPVGPGGSF
QHCGFCPSGTAASRSGVARLNSTNTIIAVTVLDSEGKSMRYTPRLLYSCPGSRGPQVGGQ
REAQGLGEQYPPHP
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgagtgagcactcggtagcaagcactctgggggccatgaccctggaagaacccgggggc
gaacaggtctcccctcgggccccggggcctcttcgctgtgggccctgtgcggtgtggcac
cggcagcagacctggctgtgcgcagtgcccttagtgatgggcttcgtgggcctgggcctt
agtctcatgctgctcaaatggattgtagtgggttccgttcaagactatgtgcccacagac
ctagtggatgccaagggcatagggcaggaccccatctttctctccgaacccagcgctcca
cccaagcggccagacactatgaccacgactacaaagaccactgccaccgcgtttgtctcc
accacctctctagaggccgacggcacggtcccagccccgagaactcaatttgggttgccc
tccaaccactcggtcccgcacctccacaactgggttggcagtggcacccgtgtgactggc
accaccacccgcaccacacgactccccccgcccgggggtaaagaagtgaccccacacagc
accacggtactttgggtcagcggcacagccaatggtcgtaaggataaggaccccccgaac
tcacgagccggtccaacctccaaagctactagcacaacctctaccgccaacaccacaacc
aaggcgctaccaccaacttttccaccatctcccccagccaagcccaccgggcactggaaa
cctggacgctctgcgaaaggtcccgctacacgccctcaccaccgctacagaacactggct
cccacatcccctagtctgcgttcggatgtcttcaagtcatgcatcgacgacaaggatctg
gccttctgcctcaacgagggcgagtgctccatcattgaaacagtagcaggagtacacagg
cactgcaggtgtaaagagggttaccacggactacgctgtgaccagtttgtacccaagacg
gactccatcttatctgacccaacagatgaactgggcatcaagttcatggaaagccgtgag
acttaccagaggaaggtgctgtccatcttcagcattgcctcaggaatcggttttctcgga
gtggcatgcatggctctctaccgccgcaacaagagacacagggaaaagctccgggcacac
ttcttggagagccgtaacctgagggtgtgcagtatcaacgcctctgggttcatgtctaaa
tccagccccaggcctcagtgtggctggcagcttcaaacgtgctacaaatctcatgggtcc
tcccctcctcaagggtgcagcagtctgtcagctggcgcacccacagcagctccaccgctt
ctcaacagagcactcaccaaagggaaaagcttcaggagtagctccctgtccctcagttca
gcccaaagacaccaggacactcatcacttcaggaccctgccaatctctcggggaccaagg
gttgctgtcccagcctataagcacctgcaagaggtagagtctacagagatggaggcggaa
tctttaagagggtttgacactgggagggatggtggtgacgactgccagcgcagcgggttc
cagaatatgcaaaccctgtctcgttccgcgtggaagaaagattggagggaggtgccctac
acccgtctggacagaggactaaaacctgctcctccctctctccgcacacgatcggtcccc
atcatcccctctctccagggacatgaccgtgaggggggtcacatggataagaccaggcag
ggggtctcgcagggagggggtctcgctgggccaggtcacaaggcccaaggacctgccagt
ggcagcagccacaccccccgtcactcaaccacctcttcctctgagactgtactagaatct
gaggccagacccagtcatgtgcgtccctgcggcgctaagactgcactggggttagggaca
agccctagccacatgcaccatggctcctctgaaactccagtagggccagggggctcattc
caacactgtggcttttgtccctccgggacagcagcatccagatcaggtgttgccaggttg
aacagcacgaacactattattgctgtgaccgtgctggattccgagggaaagagcatgcga
tatacacccagactgctatacagctgtcccgggagcaggggtcctcaggtaggaggccaa
agggaggcccaggggctcggtgaacaataccccccccacccctga

KEGG   Salmo salar (Atlantic salmon): 106579414
Entry
106579414         CDS       T04363                                 

Definition
(RefSeq) pro-neuregulin-3, membrane-bound isoform-like
  KO
K05457  neuregulin 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106579414
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106579414
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106579414
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 106579414
NCBI-ProteinID: XP_014014780
UniProt: A0A1S3NHQ8
LinkDB
Position
ssa19
AA seq 748 aa
MSEHSGTSTLGAMTLEEPGDEQASPRAPGPLRCGPCAVWSRQQTWLCAVPLVMGFVGLGL
SLMLLKWIVVGSIQDYLPTDLVDAKGIGQDPIFLYEPSALPKRPDTMTTTSTTNPLASDG
TAPAPRTRFAPPSNHSAPHLHNRIGSGTHVMGTTTTTRTTRLVPPGGKEVTPHSTTVQQN
GNTGNGRKDKDPPNSRPSPTSTTTKATTKVQSPTSPPSPPAKPTGRWNPGRSVKGPATRP
HHRFRTLAPTSPSLRSEVFKPCIDDKDLAFCLNEGECSIIETVAGVHRHCRCKEGYHGLR
CDQFVPKTDSILSDPTGELGIEFMESRETYQRQVMSICSIASGISFLGVACMALYCRNKR
HREKLHMQFSESWNLRECGINSSGRMSKSCPRPQCGLQLQKQCCKSHGSSPPEGDSSLPA
GTPTAGPPILNRALSKGKRFRSSSLSLSPVQRHWDTHHMRTPPISRGPSVAGPAYKHLEE
VESTEMEAESLRGFDTGRDGGDDRQHSRFPNMQTMSRSAEKGWRDVPCTRLDKGITPAPP
SLRTHSVPIIPSLQEHDHEGGHVDGSKERVSHGGGLARPGYMAQAPAGGSSHTPPNSSSS
TSVTVLELEDRPSHVRPYNIKTALGSETSPIHTHQGSSETLVGPGDPFQHSSLVASGTAE
SGSGVAGLNSTNTFIAVTVLESKKKSMRYTPRLLYSFPKSRGPQAGVQREAQGLGKQNVP
LVNGGANGFLSTVVGKGAGISWAKPSAS
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgagtgagcactcaggaacgagcactctgggggccatgaccctggaggaacccggggat
gaacaggcctcccctcgggccccggggcctcttcgctgtgggccctgtgcagtgtggtcc
cgccagcagacctggctgtgtgcggtgcccttggtgatgggctttgtgggccttggcctc
agtctaatgctgctcaaatggattgtagtgggctccattcaagactatctgcccacggac
ctggtggacgccaagggcatagggcaggatcccatatttctctatgaacccagcgccctg
cccaaacgaccagacactatgaccacgacttccaccaccaaccctctagcgtctgatggc
acggccccagccccgagaactcgatttgcgccgccctccaaccactcggccccgcacctc
cacaaccggatcggcagtggcacccacgtgatgggcaccaccaccactacccgcaccact
cgacttgtcccgcccgggggtaaagaggtgaccccgcacagcaccacggtacagcagaac
ggcaacacgggaaacggtcgtaaggataaggaccccccgaactcacgacctagtccaaca
tccacaactaccaaagccacaaccaaggtgcaatcgcccacttctccgccatcgccccca
gccaagcccaccgggcgatggaaccctggacgctctgtgaaaggtccagccacacgccca
caccaccgcttcagaacactggcccccacatcccctagtctgcgttcagaggtcttcaag
ccttgcatcgatgacaaggacctggccttctgcctcaacgagggcgagtgctccatcatt
gagacagtagcaggagtgcacagacactgcaggtgtaaagagggttaccatggactacgc
tgtgaccagttcgtacccaagacggactccatcttatctgacccaacgggtgaactgggc
atcgagttcatggagagccgtgagacttaccagagacaggtgatgtccatctgcagcatc
gcctcaggaatcagttttctcggagtggcgtgcatggctctatattgccgcaacaagaga
cacagggaaaagctacatatgcaattctctgagagctggaacctgagggagtgcggaatc
aactcctctgggcggatgtctaaatcctgccccaggcctcagtgcggcctgcagcttcaa
aagcagtgctgcaaatctcatgggtcctctcctcctgaaggggacagcagtctgccagct
ggcacacccacagcaggtccacctattctcaacagagcactctccaaagggaaacgcttc
aggagtagctccctgtccctcagtccagtccaaagacactgggacactcatcacatgagg
accccgcccatctctcgaggaccaagtgttgctggccccgcatataaacacctggaggag
gtggagtctacagagatggaggcagagtctttaagaggctttgacactggaagggatgga
ggtgacgatcgccagcacagcaggttcccgaatatgcaaaccatgtctcgttctgcagag
aagggatggagggatgttccctgcacccgtcttgacaaaggaataacacccgctcctccc
tctctccgcacacactccgtccccatcatcccctctctccaggaacacgaccacgagggg
ggtcacgtggacgggagcaaggagagggtctcgcatggaggaggtcttgccaggccaggt
tacatggcgcaggcacctgccggtggcagcagccacacaccccctaactcctcctcctcc
acctctgtgactgtactagagttagaggacagacccagtcatgtgcgtccctacaacatt
aagactgcactggggtcagagacaagccctattcacacgcaccagggctcctctgaaact
ctagtagggccaggggacccgttccaacactctagccttgtggcctctgggacagcagaa
tccggatcaggtgttgccgggttgaacagcacaaacacttttattgctgtgaccgtgctg
gagtccaagaaaaagagcatgcggtatacacccagactgctctacagctttcccaagagc
aggggtcctcaggcaggtgtccaaagagaggcccaggggcttggtaaacaaaacgtcccc
ctggtgaatggaggggcaaacggcttcctgtcaacagtggtgggaaaaggtgctggaatt
tcttgggccaaaccttctgccagctga

KEGG   Salmo salar (Atlantic salmon): 106607935
Entry
106607935         CDS       T04363                                 

Definition
(RefSeq) pro-neuregulin-3, membrane-bound isoform-like
  KO
K05457  neuregulin 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106607935
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106607935
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106607935
SSDB
Motif
Pfam: EGF EGF_2
Other DBs
NCBI-GeneID: 106607935
NCBI-ProteinID: XP_014060896
UniProt: A0A1S3S980
LinkDB
Position
ssa01
AA seq 701 aa
MSESSGAVTSGVVILEECPEGSREREQDQGQEPGPLRCGGCTVWPRQQTWLCVVPLLIGF
IGLGLSLMLLKWIVVGSVRDYVPTDLVDAKGIGQDPMFPPHLSKPSTFPKNSDTTTTTTT
TMANPTSTTVTAVRGRTRTVVAHHPSGTTTTAKVGGASGSQVTPRSTTQRQGNSGGGRPQ
GPVITTTTAAPVVIFTTSSPSPFNPTVLHDSTEMWTHKHSTERPATNPTRTHVNRKTSSP
TIPQMRSEHFKQCHVKDLAYCLNDGECFVIETLSGPHKHCRCKEGYQGIRCDQFLPKTDS
ILSDPTDHLGIEFMESKEVYKRQVLSITCITMGISVLGILCMALYCRNKRCREKLQAHLK
ESRSLKNYSGNASALESKSSLRPDTGLQLQNYCKRSSQPHEGAVCKSSFSQCNATPTNYS
RGPGTGKHYRSSSLSHSPDQISKATHWSVPRKTPPIPRGRRNPIGGSKNSGPAYQHLQEL
ESSEREVELLKGYQIVRAGSDPQQDAFLNMQPPMLIERSWESRVEVRCSLLNQGQDHDIS
TSTRTLRCPRHPSLSSPSPFQTCSIPIIPSVQGNQDEVSCLQTTTTGSATCSATPSMEVG
GGCSLITLHHASTSCSSSTGGQQQDEMALILEEAQEHLRALTLANRKQEESGGFSPSTPR
ETVCFLTLNGGGVRGLIPNGPIETQLLSPREPHTDSTQPCQ
NT seq 2106 nt   +upstreamnt  +downstreamnt
atgagcgagagctccggagcagtcacatccggggtggtgatcctggaggagtgtccagag
gggagtagggagcgagagcaggaccaaggccaagagccagggcccctgcgctgtggaggc
tgcaccgtgtggccccgccagcagacatggctatgtgtggtccctctgctcataggcttc
attggcttgggactaagcctgatgctgctcaaatggattgtggtgggctctgttagggac
tacgtgcctacagacctggtggacgctaagggtataggacaggaccccatgtttcccccc
catctctccaagcccagcaccttccccaagaactcagacactaccactacaaccactact
accatggcaaaccccacctcaaccaccgtcacagcggtgaggggcagaactcgaactgtt
gtcgcacaccaccccagtggcaccactactaccgctaaggtgggtggtgcatcaggcagc
caagttacacctcgcagcaccacacaacgccaaggcaactccgggggcggaagaccacaa
ggccccgttattaccacaaccaccgctgcgccagttgtcatttttaccacctccagcccc
tctccttttaaccccaccgtgctgcatgactccacagaaatgtggacgcacaagcactcc
acggagaggcctgccaccaaccccacacggacccatgtgaaccgaaaaacatcgtcaccc
accattcctcaaatgcgctcagagcatttcaagcaatgtcacgtgaaggacctggcctac
tgcttgaatgatggagaatgctttgtcatcgagacgctgagtggcccacacaaacattgc
aggtgtaaagaaggctaccaaggtatacggtgcgaccagttcctgccgaagaccgactcc
atcttatctgatccgacagatcacttgggcattgagtttatggagagcaaggaggtgtac
aagagacaagtgctgtcaatcacctgcatcaccatggggatcagtgttctgggcattctc
tgtatggctctctactgtcggaacaagagatgcagagaaaaactccaggcccacttgaaa
gagagtcgcagcctcaaaaactacagcggcaacgcctctgctttggagtccaaatccagc
ctgaggcctgacacgggcctgcagctgcagaattattgtaagaggtcctcccagccacat
gagggagctgtttgtaagtccagcttttcccagtgcaacgccacccctaccaactactcc
agaggtccaggcacaggaaaacattacagaagcagctccctgtctcatagtccagaccag
ataagtaaagccacccattggtcagtacctcgtaaaactccgcccatacccagaggaaga
cgaaatccaattggaggatccaaaaattctggccccgcctaccaacacctccaggaattg
gagtcgtctgagagggaggttgaattattgaaagggtaccagattgtgagggctgggagc
gacccgcaacaggatgcctttctaaatatgcaaccccccatgttgattgagcggtcatgg
gagagcagggtggaggtgcgctgcagtcttctgaaccagggccaggaccatgatatctcc
acctctaccaggaccctcaggtgccccagacatcccagcctctcatcaccttctccattt
cagacctgctccatccccatcatcccctcagtccagggcaaccaggatgaggtctcctgt
ttgcaaacgaccaccacaggctcagccacctgcagcgccacgcccagtatggaagtagga
ggaggatgctccctcatcacgctgcaccacgcctccacctcctgctcctcctctacgggg
ggccagcagcaggatgagatggcccttatcctggaggaggcccaggagcatctcagggct
ctgactctggccaacaggaagcaggaagaaagcggcggcttttccccttcaacacccaga
gagactgtgtgcttcctgacactcaatggcggaggagtgaggggtttgatccctaatgga
cctattgagacccagttactgagccctagagaaccccacacagactcaactcagccctgc
caatga

DBGET integrated database retrieval system