KEGG   Salmo salar (Atlantic salmon): 106577430Help
Entry
106577430         CDS       T04363                                 

Gene name
TRY1
Definition
(RefSeq) trypsin-2-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106577430 (TRY1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sasa01002]
    106577430 (TRY1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106577430 (TRY1)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     106577430 (TRY1)
Peptidases [BR:sasa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106577430 (TRY1)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106577430 (TRY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 106577430
NCBI-ProteinID: XP_014010878
UniProt: B5X8D4
LinkDB All DBs
Structure
PDB: 

Position
ssa02
AA seq 242 aa AA seqDB search
MISLVFVLLIGAAFATEDDKIVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAH
CYKSRVEVRLGEHNIQVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYV
QPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMF
CAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMA
TY
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgatttctctggtcttcgttctgctcattggagccgcttttgctacggaggacgacaag
atcgtcggagggtatgagtgcaagccctactcccagccccaccaggtgtctctgaactct
gggtaccacttctgtggtggctccttggtcaatgagaactgggttgtgtctgctgctcac
tgctacaagtcccgtgtggaggtgcgtctgggcgagcacaacatccaggtgactgagggt
agcgagcagttcatctcttcatcccgcgtgatccgtcaccccaactacagctcctacaac
atcgacaatgacatcatgctgatcaagctgagcaaacccgccaccctcaacacctacgtg
cagcctgttgctctgcccaccagctgtgcccccgctggcaccatgtgtaccgtctctgga
tggggcaacaccatgagctctaccgctgacagcaacaagctgcagtgcctgaacatcccc
atcctgtcctacagcgactgtaacaactcctaccctggcatgatcaccaacgccatgttc
tgcgctggatacctggagggaggcaaggactcttgccagggtgactccggtggccctgtg
gtgtgcaacggtgagctgcagggtgttgtgtcctggggttacggctgtgccgagcccggt
aaccccggtgtctacgccaaggtgtgcatcttcaatgactggctgaccagcaccatggcc
acctattaa

DBGET integrated database retrieval system