KEGG   Salmo salar (Atlantic salmon): 106577543
Entry
106577543         CDS       T04363                                 

Definition
(RefSeq) transcription factor p65-like
  KO
K04735  transcription factor p65
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04137  Mitophagy - animal
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04623  Cytosolic DNA-sensing pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106577543
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106577543
  09143 Cell growth and death
   04210 Apoptosis
    106577543
   04218 Cellular senescence
    106577543
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106577543
   04621 NOD-like receptor signaling pathway
    106577543
   04622 RIG-I-like receptor signaling pathway
    106577543
   04623 Cytosolic DNA-sensing pathway
    106577543
   04625 C-type lectin receptor signaling pathway
    106577543
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106577543
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106577543
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106577543
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106577543
Transcription factors [BR:sasa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    106577543
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer PBP_N
Other DBs
NCBI-GeneID: 106577543
NCBI-ProteinID: XP_014011133
UniProt: A0A1S3N6L0
LinkDB
Position
ssa18
AA seq 611 aa
MDGIYGWEQPPLNQGNPFIEIIEQPKQRGMRFRYKCEGRSAGSTPGEKSNDTTKTHPAIK
VHNYNGPLRVRVSLVTKNPPHKPHPHELVGKDCKHGYYEADLQERRVHSFQNLGIQCVKK
KDVAEAVSCRLQTQNNPFNIPEANVWEEFDLNAVRLCFQASITLPTGELFALEPVVSQPI
YDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFFQDAWEGKGTFSQAD
VHRQVAIVFRTPPYCDTNLTEPIRVKMQLRRPSDREVSEPMDFQFLPSDPDEYKLMEKRK
RTEGMLQNLKLGSLMSGAMPAETRPFNIARRTVTAKPAASQPVMNQVAPPSAVSVKPQPY
YNGPQPGQLFQTQPKAEASTTAETWKFLNSLTLDSQPKATPVASFITNPQASVATAASSQ
DFPTVNLLDLHGYAFHTFASPQEPVSAAATTEPTSTFGVQGSQFKVDEELPEFPSFEAQP
TGTLDSINFDDFQAMLGQSCLAGEGPKSSEASAPQAPCHLPSTNTVANNAAQNQADPANH
HISCGGSTWMNYPNSIVNLLQNEGMMDSSPGNASQPAALDDLDVLSSMDEDHLMSILSSG
NQYTFVSGHQT
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggatggaatttatggatgggaacagccccctttgaaccaaggtaatcccttcatagag
atcattgaacagcccaagcagaggggcatgaggttcaggtacaaatgtgaggggcgctct
gcgggaagcaccccgggagagaagagcaatgacaccaccaagacacaccccgccattaag
gtgcacaactacaatggccccctgcgtgtccgcgtctccttggtgaccaagaacccacct
cacaagccccacccccacgaactggtggggaaagactgcaaacatggctactatgaggca
gacctgcaggagagacgagtacacagttttcagaacctgggcattcagtgtgtgaagaaa
aaggatgtggccgaggcagtttcctgtaggctgcagacccaaaacaaccccttcaacatt
cctgaggcgaacgtgtgggaggagtttgacctaaatgcagtgaggctgtgtttccaggcc
tcgatcactctgcctaccggggaactcttcgctctagagcccgtggtgtcccagcccatc
tacgacaacagagcacccaacacagcagaactgaagatctgtcgagtgaacagaaactct
ggaagctgcagagggggggatgagatcttcttactttgtgacaaagtgcaaaaagaggac
attgaggtgcggttcttccaggatgcgtgggaggggaagggcaccttctcccaggcggat
gtccacaggcaggtggccattgtgttccgcacccctccctactgcgacaccaacctgacc
gagccaatccgagtgaagatgcagctccgcaggccctcggaccgtgaggtcagcgagcca
atggacttccagttcctgccctccgacccagatgaatataaactgatggagaagagaaaa
cggacagaaggaatgttacagaatctgaagctggggtccctgatgtcaggggccatgcca
gcagagacgaggcctttcaacattgccaggagaacagtcaccgctaagccagcagctagc
cagcctgtgatgaaccaagtggcgccccctagtgctgtctctgtgaagccccagccctac
tacaacggcccccagccaggccagttgtttcaaacccagcccaaagcagaagcctccacc
acagccgagacctggaagttcctcaacagcctgaccctggactcccagcccaaagccacc
cccgtggccagcttcatcaccaacccccaggcctctgtagccacagccgcctcttcccag
gactttcccaccgtaaacctgttggacctccacggatacgctttccacacctttgctagt
ccccaggagccggtgagtgcagctgctaccacagagcccacctctaccttcggggtccaa
ggctcccagttcaaggtggacgaggagctacccgaattccccagctttgaggcacaaccg
accgggactctagatagtataaacttcgacgacttccaggctatgctgggccagagttgt
ctggctggagaagggccaaagagcagtgaggcgtcagcccctcaggcaccctgccactta
ccttccaccaacactgtggccaacaacgcggcccagaaccaagcagacccagccaaccac
cacatcagctgtggcggcagcacctggatgaactaccccaacagcattgtcaacctgctc
cagaacgagggcatgatggacagttcccccggcaacgccagccagccggccgcccttgac
gacctggacgtcttaagctccatggatgaagaccatctcatgtccatcctgagcagtggc
aaccaatacacttttgtgtccggacatcagacctaa

DBGET integrated database retrieval system