KEGG   Salmo salar (Atlantic salmon): 106577554
Entry
106577554         CDS       T04363                                 

Definition
(RefSeq) cellular tumor antigen p53-like
  KO
K04451  tumor protein p53
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04137  Mitophagy - animal
sasa04210  Apoptosis
sasa04216  Ferroptosis
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106577554
   04310 Wnt signaling pathway
    106577554
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106577554
  09143 Cell growth and death
   04110 Cell cycle
    106577554
   04210 Apoptosis
    106577554
   04216 Ferroptosis
    106577554
   04115 p53 signaling pathway
    106577554
   04218 Cellular senescence
    106577554
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106577554
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106577554
   03036 Chromosome and associated proteins [BR:sasa03036]
    106577554
   03400 DNA repair and recombination proteins [BR:sasa03400]
    106577554
Transcription factors [BR:sasa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    106577554
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106577554
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    106577554
SSDB
Motif
Pfam: P53 P53_tetramer TFIIE-A_C P53_TAD
Other DBs
NCBI-GeneID: 106577554
NCBI-ProteinID: XP_014011157
UniProt: A0A1S3N6N6
LinkDB
Position
ssa18
AA seq 392 aa
MEEQELSFPMSQGSFQQLWETNMTTQGPNIPPFVNENWSDLDVSLAPVLPEATFHEVFDE
GLFELSEPLAVEPSMSPLDSVPPPASTVPSTIDYPGEHGFQLRFHKSGTAKSVTSTYSVQ
LIKLYCQRAKTCPVEVLMTKEPPPGAILRATAIYKKSEHMSEVVSRCPHHQSTSDSYEGV
THRSHLIRVEGSQRAQYLEDGNTKRQSVLLPYEPPQLGSEATTVLLNFMCNSSCMGGMNR
RPILTILTLETQDGQVLGRRCFEVRVCACPGRDRKTEEENANKALNGTKNTNGTKRKSQP
ALPPPGTSKKIKSGSSTEDEDKDNVFLLQVRGRQRYEWLKKINDSLELMDRIPPAEQEKY
KKKGFSKSRKQEALAPKSGKRMLTKEERSDSD
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggaagagcaggagttgagcttccccatgagccaggggtccttccagcagctttgggag
accaacatgactactcagggccccaatattccaccgtttgtgaatgaaaactggtctgac
ctggatgtctcgctcgctcccgtacttcccgaggccaccttccacgaggtttttgacgag
gggctgtttgagctgtctgagcccctggccgtggagccctcgatgtcgcccctggacagc
gtgcctccccccgcctccaccgtcccctccaccattgactacccgggggagcacggcttc
cagctgcgcttccacaagtctggcaccgccaagtctgtcacctccacctattctgtgcag
ctgatcaagctgtactgccagcgggctaagacctgcccggtggaggtgctgatgaccaag
gagcccccgccaggagccatcctacgtgccaccgccatctacaagaagtcagagcacatg
tccgaagtggtcagccgctgcccccaccaccagagcacgtctgacagctatgaaggtgtg
acccaccgcagtcacctgatcagggtggaggggagccagcgggctcagtacctggaggat
ggcaacaccaagcgtcagagcgtgctgctgccttatgagcctcctcagctgggctctgag
gcaactactgttctcctgaacttcatgtgcaactccagttgcatgggtggtatgaaccga
cggcccattctcaccatcctgacgctggagacccaggatggtcaggttttgggtcgccgt
tgttttgaggttcgagtctgtgcctgccccggccgggaccgcaagaccgaggaagagaac
gctaacaaagctctgaacgggaccaagaacaccaacggcaccaaaagaaagtcccaacct
gccctgccgcctccgggaaccagtaagaagatcaagagcggctccagcactgaggatgaa
gacaaggacaatgtattcttgttgcaggtacgtggaagacagcgctatgagtggctcaag
aagatcaacgacagtctggagctgatggaccgcattcctcccgctgagcaggagaaatac
aagaagaaaggtttctcaaagagccgcaagcaagaagcgttggccccaaaaagtggaaaa
cggatgcttacaaaggaggagaggagcgactcggactaa

KEGG   Salmo salar (Atlantic salmon): 106602901
Entry
106602901         CDS       T04363                                 

Gene name
tp53, P53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04137  Mitophagy - animal
sasa04210  Apoptosis
sasa04216  Ferroptosis
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106602901 (tp53)
   04310 Wnt signaling pathway
    106602901 (tp53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106602901 (tp53)
  09143 Cell growth and death
   04110 Cell cycle
    106602901 (tp53)
   04210 Apoptosis
    106602901 (tp53)
   04216 Ferroptosis
    106602901 (tp53)
   04115 p53 signaling pathway
    106602901 (tp53)
   04218 Cellular senescence
    106602901 (tp53)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106602901 (tp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106602901 (tp53)
   03036 Chromosome and associated proteins [BR:sasa03036]
    106602901 (tp53)
   03400 DNA repair and recombination proteins [BR:sasa03400]
    106602901 (tp53)
Transcription factors [BR:sasa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    106602901 (tp53)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106602901 (tp53)
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    106602901 (tp53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 106602901
NCBI-ProteinID: XP_014051360
UniProt: A0A1S3RGF1
LinkDB
Position
ssa04
AA seq 430 aa
METSFSTTFPGITNDSPGWLFFPACCFQVLENAIMADLVENVSLPLSQESFEDLWKMNLN
LMAVQPPVTDAWEGYDNFMMETPLQEEFDPSLFEVSATEPAPQPSISTLDTGSPPTSTVP
TTSDYPGALGFQLRFLQSSTAKSVTCTYSPDLNKLFCQLAKTCPVQIVVDHPPPPGAVVR
ALAIYKKLSDVADVVRRCPHHQSTSENNEGPAPRGHLVRVEGNQRAEYMEDGNTLRQSVL
VPYEPPQVGSECTTVLYNFMCNSSCMGGMNRRPILTIITLETQEGQLLGRRSFEVRVCAC
PGRDRKTEEINLKKQQETTLETKTKPAQGIKRSMKEASLPAPRPEASKKTKSSPAVSDDE
IYTLQIRGKEKYEMLKKFNDSLELSELVPVADADKYRQKRLTKRVAKREIGVGPKKGKKL
LVKEEKSDSD
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggagacctctttctctactacttttccaggcatcaccaatgacagccccggttggctt
ttcttccctgcgtgctgctttcaggtcctagagaacgctatcatggctgatctggtggag
aacgtgtctcttccccttagccaagagtctttcgaggacctgtggaaaatgaatttgaac
ctgatggcagttcaaccacctgtaaccgacgcttgggagggatatgataatttcatgatg
gagacccctctccaggaggaatttgatccgagtctgtttgaggtgtctgcaacggagcct
gcaccccagccctccatctctaccctggacactggctcgccacctacctccaccgtacca
accacctctgactaccctggggccctggggttccagctacgtttcctccagtccagcaca
gccaagtccgtcacttgcacatactcgccagacctgaacaagttgttctgccaattggca
aagacttgtccagttcagattgtggtggaccaccctcctcctcctggggcagtggtacga
gccctggccatctataagaagctgagtgacgtggctgacgtggtgagacgctgccctcac
caccagagcaccagcgagaacaatgaaggtcctgccccgcgaggtcacctggtcagagtt
gaggggaaccagcgagcagagtatatggaggatggtaacactctgagacagagtgtgctt
gtcccctatgagcctcctcaggtgggatcagagtgtaccactgtgctctacaacttcatg
tgcaacagctcctgtatgggagggatgaaccgcagacccatcctcaccatcatcaccctg
gagacacaggaggggcagctcctgggccggcgctcctttgaggtgcgtgtgtgtgcctgt
cctggtcgtgacaggaagacagaggagatcaacctgaagaagcagcaggagacaaccctg
gagaccaagaccaagcctgcccagggaatcaaacgctctatgaaggaggcctccctgcct
gcccctcggcctgaggccagtaagaagaccaagtcctcccctgctgtgagcgacgatgag
atctacactcttcagattcgagggaaggaaaaatatgagatgctgaagaagttcaatgac
agtcttgaactgagtgagttggtgcctgttgccgacgctgacaaataccgtcagaaacgc
ctcaccaagagagttgccaaacgggaaatcggagtggggccgaagaaagggaagaaacta
ctggtgaaggaggagaagagcgactctgactga

KEGG   Salmo salar (Atlantic salmon): 106608673
Entry
106608673         CDS       T04363                                 

Gene name
P53
Definition
(RefSeq) cellular tumor antigen p53-like
  KO
K04451  tumor protein p53
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04137  Mitophagy - animal
sasa04210  Apoptosis
sasa04216  Ferroptosis
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106608673 (P53)
   04310 Wnt signaling pathway
    106608673 (P53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106608673 (P53)
  09143 Cell growth and death
   04110 Cell cycle
    106608673 (P53)
   04210 Apoptosis
    106608673 (P53)
   04216 Ferroptosis
    106608673 (P53)
   04115 p53 signaling pathway
    106608673 (P53)
   04218 Cellular senescence
    106608673 (P53)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106608673 (P53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106608673 (P53)
   03036 Chromosome and associated proteins [BR:sasa03036]
    106608673 (P53)
   03400 DNA repair and recombination proteins [BR:sasa03400]
    106608673 (P53)
Transcription factors [BR:sasa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    106608673 (P53)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106608673 (P53)
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    106608673 (P53)
SSDB
Motif
Pfam: P53 P53_tetramer TFIIE-A_C
Other DBs
NCBI-GeneID: 106608673
NCBI-ProteinID: XP_014062243
UniProt: A0A1S3SD25
LinkDB
Position
ssa07
AA seq 393 aa
MEELSQCSFQQLWESNMTPQGPSIPLGATENWPDLDVSINGIHLPPSQLLPDATLHKVFD
EGLFELLEPPVVEPSVSTLDSVPPTASTVPSTNDYPGKHGFQLRFQKSGTAKSVTSTYSV
QLNKLYCQLAKTCPVEVLMAMDPPPGAILRATAIYKKSEHVSEVVRRCPHHQSASDNNEG
VVHRSHLIRVEGSQWAQYLEDGNTKRQSVLLPYEPPQLGSETTTVLLNFMCNSSCMGGMN
RRPILTILTLETQEGQVLGRRCFEVRVCACPGRDRKTEEENTNKVLNGTKTTNGAKRKSQ
QTLPPPGTSKKIKNGSSTEDEDKDNVFLLQVRGREHYEWLKKINDSLELMDHIPPAEQEK
YKKKGSAKILKQEAMAPKSGKRLLTKEDRSDSD
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggaagagctcagccaatgttccttccagcagctttgggagagcaatatgacacctcag
gggcctagtattccactgggtgctactgaaaactggcctgacctggatgtctcgataaat
ggcatccacttacctccctcacagctccttcccgacgcgactctccacaaggtctttgac
gaggggctgtttgaactgctggagcccccggttgtggagccctctgtgtcaaccctggac
agcgtgcctcccactgcctccaccgtcccctccaccaacgactaccctgggaagcacggc
ttccagctgcgattccagaagtccggtaccgccaagtctgtcacctccacttattctgtg
cagctgaacaagctgtactgccagctggctaagacgtgccctgtggaggtgttgatggcc
atggatcccccgccaggagccatcctcagggccaccgctatctacaagaagtctgagcat
gtctctgaggtggtccggcgctgtccccaccaccagagcgcctcagataacaatgaaggt
gtagtccaccgcagtcacctgattagagtggaggggagccagtgggctcaatacctggag
gatggaaacaccaagcgtcaaagtgtgctgctgccgtatgagccgcctcagctgggctct
gaaacgactactgttctcctgaacttcatgtgcaactccagttgcatgggtggtatgaac
aggcgtcccatcctcaccatcctgaccctggagacccaggagggtcaggttttgggtcgc
cgttgtttcgaggtccgtgtgtgtgcctgtcccggccgggaccgcaagaccgaagaagag
aacacaaacaaagttctgaacgggaccaagaccaccaacggtgccaagagaaagtcccaa
cagaccctgccccctccagggaccagcaagaagatcaagaacggctccagcactgaggat
gaagacaaggacaatgtatttttgttgcaggtccgtggccgagagcactatgagtggctc
aagaagatcaacgacagtctggagctgatggaccacattcctcccgctgagcaggagaaa
tacaagaagaaaggttccgcaaagatcctcaagcaagaagcaatggccccgaagagcgga
aagcggctgcttacaaaggaagacaggagcgactcggactaa

DBGET integrated database retrieval system