KEGG   Salmo salar (Atlantic salmon): 106577897
Entry
106577897         CDS       T04363                                 

Definition
(RefSeq) plasminogen activator inhibitor 1-like
  KO
K03982  plasminogen activator inhibitor 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106577897
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106577897
   04218 Cellular senescence
    106577897
Peptidases and inhibitors [BR:sasa01002]
 Peptidase inhibitors
  Family I4: serpin family
   106577897
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106577897
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   106577897
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 106577897
NCBI-ProteinID: XP_014011807
UniProt: A0A1S3N8R9
LinkDB
Position
ssa18
AA seq 391 aa
MLCLYVWFFLGLSGAAISNLQEKQTDFGMRVFSQVAQNSKGSNLAFSPYGVATILGMAQL
GAGGNTLKTLNAKLGFSLQERGMARQQRLLQRDISSEEGVELASGVMVERKMTLEKGFRR
GLGKAFQASPHQLDFSRPDQALDIINAWVSDHTAGTIPSFLSSGALTDETRMVLLNALHF
QGLWKVPFDPKMTEERLFHCANGSSVPVPMMRLTHRFKYGEFVTPDGVDYDVIEVPYEGE
SLSMLLVSPFEPETPVSSLSSELTTQRLQQWRQELRSVKRQLALPRFTLDTEVDLKSILI
KMGLGDMFNLAKADFTRITTEQPLCVSKVLQKVKIEVNEEGTKGSAATAAILFSRMAVEE
ITMNRPFLFLIHHKSTGAVLFMGQVNQPQQH
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgctgtgcctgtacgtgtggttcttcctcggcctgtccggagccgccatctctaacctc
caggagaaacagacagactttgggatgcgggtcttttcccaggtggcccagaactccaag
gggtctaacctggccttctccccctacggcgtggccaccattctgggcatggcacagctg
ggagctgggggcaacaccctgaagaccctgaacgccaaattgggtttctcactacaagag
agagggatggcgcgtcagcagcgtcttctccagcgggacatctccagtgaggagggagtg
gagctggccagcggcgtcatggtggagagaaagatgactctggagaaaggcttcaggagg
gggctggggaaagccttccaggcctcccctcaccagctggacttctccaggccagaccag
gccctggacatcatcaacgcctgggtctctgaccacactgcaggtaccatcccttcattc
ctgtcctccggtgcgctgaccgatgagacccgtatggtcctgctgaacgcccttcacttc
caggggctatggaaggtgccctttgacccaaagatgacagaggagaggctattccactgt
gccaacggcagctctgtgcccgtacccatgatgaggctcacacaccgcttcaaatacggt
gagttcgtgacccccgatggcgtggactacgacgtcatcgaggttccgtacgaaggcgag
tccctgagcatgctgctggtctcccccttcgagcccgagacgccagtgagctcactcagt
agcgagctgaccacccaacggctgcagcagtggagacaggagctgaggagcgttaaacgt
caactggccctgcctaggttcaccctggacactgaggtggatctgaagtctattctaatc
aagatggggttgggggatatgttcaacctggccaaggcagacttcacacgcatcaccact
gagcagcctctgtgtgtgtccaaggttctacagaaagtcaagattgaggtgaacgaggag
ggaactaagggatcagctgctacagctgccatcctgttctctcgtatggctgtagaggag
atcacaatgaatagacctttcctcttcctcatccatcacaagtccacaggtgctgttctg
ttcatgggtcaagtcaaccaaccccagcaacactag

KEGG   Salmo salar (Atlantic salmon): 106608947
Entry
106608947         CDS       T04363                                 

Definition
(RefSeq) plasminogen activator inhibitor 1-like
  KO
K03982  plasminogen activator inhibitor 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106608947
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106608947
   04218 Cellular senescence
    106608947
Peptidases and inhibitors [BR:sasa01002]
 Peptidase inhibitors
  Family I4: serpin family
   106608947
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106608947
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   106608947
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 106608947
NCBI-ProteinID: XP_014062667
UniProt: A0A1S3SEA9
LinkDB
Position
ssa07
AA seq 388 aa
MLCLYVCFFLSLSGAALSNLQEKQTDFGMRVFSHVAQTSRGSNLAFSPYGVATILGMAQL
GARGNTLKTLNAKLGFSLQERGMSRQQRLLQQHLSSEEGVELASGIMVEKKMALEKGFRR
GLGKAFQASPHQLDFSRPDQALESINAWVSNHTSGTIPSFLSSGALTDETRMVLLNALHF
QGLWKVPFDPKMTEERLFHCANGSSVPVPMMRLTHRFNYGEFVTPDGVDYDVIEVPYEGE
SLSMLLVTPFESEKPVSVLSSELTTQRLQQWREELRSVKRQLALPRFTLDTEVDLKSTLT
RMGLGDMFNLAKADFTRITTEERLCVSKVLQKVKIEVNEKGTKGSAATAAIMFSRMAVEE
ITLDRPFLFLIQHKPTGAVLFMGQVNQP
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgctgtgcctgtacgtgtgcttcttcctcagcctctctggagcggccctctctaacctc
caggagaaacagacagactttgggatgcgggtcttctcccatgtggcccagacttccagg
ggctctaacttggccttctcaccctacggcgtggccaccatcctgggcatggctcagctg
ggcgctaggggcaacaccctgaagacactcaacgccaaactgggcttctctctacaagag
cgagggatgtcacgtcagcagcgtctgctacagcagcacctctccagtgaggagggagtg
gagctggccagtggcatcatggtagagaagaagatggctctggagaaaggcttcaggagg
gggctggggaaagccttccaggcctcccctcaccagttggacttctccaggccagaccag
gccctggaatccatcaatgcctgggtctctaaccacacctcaggtaccatcccttcgttc
ctgtcgtccggtgctctgaccgatgagactcgcatggtcctactgaacgctctgcacttc
caggggttatggaaggtgccctttgaccccaagatgacggaggagaggttgttccattgt
gccaacggcagctctgtgcccgtacctatgatgaggctcacacaccgcttcaactacggt
gagttcgtgacccccgacggtgtggactatgatgtcatcgaggttccgtacgagggagag
tccctgagcatgctgctggtcacccccttcgagtccgagaagccagtgagcgtgctcagt
agcgagctgaccacccaacgcctgcagcagtggagagaggagctgaggagcgtcaagcgt
caactggctctgcccaggtttaccctggacactgaggtggatctgaagtctacactgacc
aggatggggttgggggacatgttcaacctggccaaagcagacttcactcgcatcaccact
gaggaaaggctgtgtgtgtccaaggttctgcagaaagtcaagattgaggtgaacgagaag
ggaaccaagggatcagctgccacagctgccattatgttctctcgtatggctgtagaggag
atcaccctggacaggcccttccttttcctcatccaacacaagcccacaggtgctgtactg
ttcatgggtcaagtcaaccaaccctag

DBGET integrated database retrieval system