KEGG   Salmo salar (Atlantic salmon): 106578507Help
Entry
106578507         CDS       T04363                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00010  Glycolysis / Gluconeogenesis
sasa00053  Ascorbate and aldarate metabolism
sasa00071  Fatty acid degradation
sasa00280  Valine, leucine and isoleucine degradation
sasa00310  Lysine degradation
sasa00330  Arginine and proline metabolism
sasa00340  Histidine metabolism
sasa00380  Tryptophan metabolism
sasa00410  beta-Alanine metabolism
sasa00561  Glycerolipid metabolism
sasa00620  Pyruvate metabolism
sasa01100  Metabolic pathways
Module
sasa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106578507 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    106578507 (ALDH2)
   00620 Pyruvate metabolism
    106578507 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106578507 (ALDH2)
   00561 Glycerolipid metabolism
    106578507 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    106578507 (ALDH2)
   00310 Lysine degradation
    106578507 (ALDH2)
   00330 Arginine and proline metabolism
    106578507 (ALDH2)
   00340 Histidine metabolism
    106578507 (ALDH2)
   00380 Tryptophan metabolism
    106578507 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106578507 (ALDH2)
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     106578507 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 106578507
NCBI-ProteinID: XP_014012867
UniProt: B5X2T3
LinkDB All DBs
Position
ssa02
AA seq 518 aa AA seqDB search
MLRIVLSRILPRISGISNCQYSAAAIPVPSAHPEVHYNKLFINNEWQDAVSKRSFPTINP
ATGEVICQVAEADKADVDKAVKAAREAFRFGSPWRRMDASDRGLLLSRLADAIERDTAYL
AELETLDNGKPYAVSYSVDVPMVVKCLRYYAGWADKWEGKTIPIDGDFFCYTRHEPIGVC
GQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPPGVVNILP
GMGPSAGSAIASHMDVDKVAFTGSTEVGHLIQQASGSSNLKKVTLELGGKSPNIIMSDAN
MAEAVEQSHFALFFNQGQCCCAGSRTYVQDTIYDEFMERSVERAKSRVVGDPFNMKTEQG
PQVDEEQFKKILGYISSGKREGAKLMCGGGVAADRGYFIQPTIFGDVQDGMTIAREEIFG
PVMQILKFKTLEEVVERANDTKYGLAAAVFTKDIDKAHYISSGLRAGTVWINCYDVFGVQ
APFGGYKYSGNGRELGEYGLDNYTEVKTVTIKVPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaattgtgttatcccgaattttgcctcgaatctctggcatttcgaattgtcag
tattccgcggccgccattccggttccaagcgcacatcccgaagtccattacaacaagctg
ttcatcaataacgagtggcaggatgccgtcagcaagaggtccttccccaccatcaaccca
gccacaggagaggtcatctgtcaggtggctgaggcagacaaggcagatgtggacaaggct
gtgaaggctgccagggaggccttcaggtttgggtcaccatggcgacgcatggacgcgtcg
gaccgcgggctgctcctgagccggctggcagacgcaatcgagagggacacagcctaccta
gcggaactggagactctggacaatgggaagccctatgccgtgtcctacagcgtggacgtg
cccatggtggtcaagtgcctcaggtactatgcaggctgggcagataagtgggaggggaag
accattcccatcgatggagacttcttctgctacacccgccatgagcccatcggtgtgtgt
ggccagatcatcccgtggaacttccctctgctgatgcaggcatggaagctggggccagct
ctggctacaggcaacactgtggtgatgaaggtggctgagcagacccccctcactgccctg
tatgtggccagtcttatcaaggaggttggtttccctccaggtgtggtgaacatcctgcct
ggtatgggtccatctgctggttctgccatcgcctcccacatggatgtggataaggtggct
ttcacaggatctactgaggtaggtcacctgatccagcaggcatctggctccagcaacctg
aagaaggtcactctggagctgggaggaaagagccccaacataatcatgtccgatgccaac
atggcggaggcggtggaacagtcccactttgccctgttctttaaccagggccagtgctgc
tgtgccggctcccgtacatacgtgcaggacaccatctatgatgagtttatggagcgcagc
gtggagcgggccaagagcagggtggtgggagaccccttcaacatgaagactgagcaggga
ccgcaggtggatgaggaacagttcaagaagattctgggctacatcagcagtgggaagcgt
gagggggccaagctgatgtgcgggggaggggtggctgcagaccgtggctacttcatccaa
ccaaccatctttggagatgtccaggacggcatgaccatcgcccgtgaggagatctttggg
ccggtgatgcagatcctgaagtttaagactctggaggaggtggtcgagagagccaacgac
acaaagtacggcctggcagctgctgtcttcaccaaagacatcgacaaggcccactacatc
tctagcggacttcgcgccggcactgtctggattaactgctatgacgtgtttggagtacaa
gcccccttcggtggctacaaatattctggtaacggtcgtgagctgggagagtatggcctg
gacaactacactgaagtgaaaacggtaacaatcaaggtccctcagaaaaactcgtaa

DBGET integrated database retrieval system