KEGG   Salmo salar (Atlantic salmon): 106578905Help
Entry
106578905         CDS       T04363                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1G-like
  KO
K04854  voltage-dependent calcium channel T type alpha-1G
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106578905
   04020 Calcium signaling pathway
    106578905
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sasa04040]
    106578905
Ion channels [BR:sasa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106578905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel DUF3043 DUF4834
Motif
Other DBs
NCBI-GeneID: 106578905
NCBI-ProteinID: XP_014013623
UniProt: A0A1S3NDT0
LinkDB All DBs
Position
ssa19
AA seq 2522 aa AA seqDB search
MMAEDGGSLSGDPGARDTEGRSSVPRTFIRLNDLTGPGGGGGVERSEMELVSAGPDGAFA
AGEEASAGGEDELPHPTLAPVVFFYLKQTTPPRSWCLKLVCNPWFERASMLVILLNCVTL
GMFQPCEDHDCESERCKILEDFDDFIFAFFAVEMVIKMVALGIFGKKCYLGDTWNRLDFF
IVLAGMLEYSLNLQNVSFSAVRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLC
FFVFFIFGIVGVQLWAGLLRNRCFLPENFSLPLSIKLETYYHTEKDDESPFICSMPRENG
MRLCSSVPTLYEEGGLQCQVNMKSYNSTDNTTCINWYQYYSNCSAGHVNPFKGAINFDNI
CYAWIAIFQVITLEGWVDIMYFVMDSHSFYNFIYFILLIIIGSFFMINLCLVVIATQFSE
TKQRESQLMREQRIRFLSNASTLASFSEPGSCYDELLKLLVHVIRKGFRQVAHVCRAVMR
RAGMNIAASPPALERERERGSQRKRRKTSRQGSVVSTKGSMSVHYLVHQHHHHHYHYHLV
NGSVRGRLGGRGVAGVGGEGGEVEMGSHSNNGGTGRLMVGPLPLPTSDLNLANPVSPANP
ALGTGSGNSSSVRSTLHTDCHLEPSTPTLLAPTTSPFSLAPTPMSRPMKRNSVPFAGPRP
KNYPTLQPSTLMEFRSGSVTASTISNINLNIPSLPLERGPSTVLDTHTPTAQLSRHDLSA
IGTLDPSFTFDPESCPYCVKALLGESEGTDGNETLGESDSEGVYELTQDLHHRDHRDHRD
SRQPRKRQRKLGTTVGRVVRAWRLVCDTFRKIVDSKYFGRGIMIAILINTLSMGIEYHEQ
PDELTNALEISNIVFTSLFALEMLLKVLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQG
GGLSVLRTFRLMRVLKLVRFMPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLF
GCKFGSERDGDTLPDRKNFDTLLWAIVTVFQILTQEDWNKVLYNGMASTTPVAALYFIAL
MTFGNYVLFNLLVAILVEGFQTEAPPVSLPSTTPLHDATAVETNQVDSKGDMGVRLAPGS
RTWSQPRSWLHPHRRPQLGSLPYRPYWAVPLSTVVSGVWETQLGPWPSVGPTGEDSKSVS
EADLSSRSMEDVNGSGKDVSGSPVVPINGHVDLKTSLTPPLITHTAATPMPVPKLPAVVD
PALGYESRRSSNVSMDLDCYDKSPISAHSTSPYAPWSSTSGWTSRRSSWNSVGRAPSLKR
TKRQSGERQSLLSGEGGSSSEDDEGGGGGTLEGDDVSLCRTDSMSQSQHRHRRMESVETR
GSIDLAPDILLQVPFLYRSASIHSSRPPSLGGLRAPEHCDCNGKGTPAPRGALAQTQLSL
EDNTEDEAAEEEVVGRFARLSRWLERKQPEWCRKRDTWSLYILPPDSRFRMACNKIITHK
MFDHIVLVIIFLNCITIAMERPRIEAYSVERIFLTLSNYIFTAIFVAEMTVKVAALGWLF
GDKAYLRSSWNLLDGLLVMISAIDILVSLVSNSSPKILGMLRVLRLLRTLRPLRVISRAP
GLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFACQGEDVRNVTNKSDCM
MANYKWVRQQYNFDNLAQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPQLNHNPWMLLY
FISFLLIVSFFVLNMFVGVVVENFHKCRRSQEAEEAKRREEKRLKRMEKKRRSKEKEMAE
AQSKPYYSDYSPTRLLIHNMCTSQYLDLFITVVIGLNVITMAMEHYQQPKELDEALRICN
YIFTLVFVLESVFKLVAFGFRRFFKDRWNQLDLAIVLLSIMGITLEEIEVNASLPINPTI
IRIMRVLRIARVLKLLKMAVGMRALLDTVMQALPQVGNLGLLFMLLFFIFAALGVELFGD
LICDELHPCEGLGRYATFKNFGMAFLLLFRVSTGDNWNGIMKDTLRDCQQENAGTCYNTV
VSPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKEAKEEAELEAELQLELQHGEGGGSGR
SPQLSPLDLGMEVGGPGVSPWRSPEREIQRRASVMVDSPQTDITTRDISSDPLLVLEPPL
EMELLDPGEPLEDNLLSVRKSMVGRTHSLPNDSYMFLPLEPFGSPGASLAPGLASQTQTT
GPQHIETINKALSGSCTSLRTQPDDRPSSSHSLSHSQSIHTLSRTLRRQVAISNDSQEVL
CSDGGEGEEVVLHVASLALSSSSSSPSHLHQQPALQLVPATPGASPQSSRPSSVHTQHPS
SHSLPPPPLPPTRPWRQDEASADQEVSLITRAGLAGIDDVIGVGLGSEEGGLEGSYKGYW
VGRGGGQLKRFHSADTQGRSVLAPRSRPLSWLDDPRRHSVEECSSVESSPQRSTTSSRFV
SRADSLQIHSQTTTHTLPSPRHKKKMSPPCISVDPPDGLEPQSGLHPAPGGLGGLGMPPP
LQGRDTSCLRRRAPSSDSKDSFDLGVGEGLGLGLCQEGGGSNTNPKLLTLSSFSFEKTSS
EY
NT seq 7569 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgaggatgggggaagtctctcaggggaccccggcgccagggacacagagggg
cgctcctctgtccccagaactttcatacggctcaacgacctgactgggcccgggggagga
ggaggcgtggaacgcagcgagatggagctggtgtcagcaggacctgatggagcctttgca
gctggggaggaggcctcagcaggcggggaagatgagctgccccaccccaccctggctccc
gtcgtgtttttctacctgaaacaaaccacccctccgaggagctggtgtctgaagttggtc
tgcaacccgtggtttgagcgagcctccatgctggtgatcctgttgaactgtgtcaccctg
gggatgttccaaccctgtgaggaccacgactgtgagtcagaacgatgcaagatcctggag
gattttgatgactttatctttgcgttctttgcggtggagatggtcatcaagatggtggcg
ctgggcatcttcggcaagaagtgttatctaggagacacctggaacagactcgacttcttc
atcgtgctggccgggatgctggagtactctctgaacctgcagaacgtcagtttctcggca
gtgagaacggttcgagttctgagaccccttcgagccatcaacagagtgcctagtatgcgt
atcctggtgaccctgctcttggacaccctgcccatgctggggaacgtcctgctgctctgt
ttcttcgtcttcttcatcttcggcatcgtgggtgttcagctgtgggcggggctactgagg
aaccgctgcttcctgcccgagaacttctcactccctctgtccatcaaactagagacctac
taccacacagagaaggacgatgagagtcccttcatctgctccatgcccagggagaacggc
atgcgtctgtgttcctctgtgcccaccctgtatgaggagggaggtctccagtgccaggtg
aacatgaagtcctacaacagcacagacaacaccacctgtatcaactggtaccagtactac
agtaattgctccgcgggacacgtgaaccccttcaaaggggccatcaactttgataacatc
tgctacgcctggatcgccatctttcaggtgatcactctggagggatgggtggacatcatg
tactttgtgatggattctcactccttctacaacttcatctacttcatcctcctcatcatc
attggctctttcttcatgatcaacctgtgtctggttgtcatcgccacccagttcagtgag
accaagcagagggagagccagctgatgagggaacagcgcatccgtttcctgtccaatgct
agtaccctggcctccttctctgagccgggctcctgctacgacgagctgctcaaactcctg
gtccacgtcatccgcaaggggttcaggcaggtggcccatgtctgccgggccgtgatgcgc
cgtgctgggatgaacatcgcagcctctcctcctgccctggagagagagagggaaaggggg
agccagagaaagaggaggaagacttcgcgacagggttctgtggtctccacaaaagggtct
atgtccgttcattacttggttcaccaacatcaccatcatcattatcactatcacttagtg
aacgggagtgtgagagggagactaggggggagaggggtggcgggggtcgggggagaaggg
ggggaagtggagatgggttcccatagcaacaacgggggcactgggcgtctcatggtgggt
cctcttccgttgccgacctctgacctgaacttggcaaacccggtgtcaccggccaatccc
gctctgggaaccggcagtggcaactcgtcatcagtgcggagcacattacacacagactgc
cacctggagcccagcacccccacactcctcgcccctaccactagccccttctccctggcc
cctacgcccatgtccaggcctatgaagaggaactcagtgccgttcgctggtcccagacct
aaaaactaccccaccctacagcccagcacactaatggagtttagaagtggcagtgttaca
gctagtaccattagtaatataaacctcaatataccctctctacccctggagagaggacca
tcgactgtgttagacacacacacacccacagcccagctctcacgacatgacctgagtgcc
atcggaaccctggacccctcgttcacctttgaccctgagtcgtgcccctactgtgtcaag
gctctgttaggggagtcagaaggcacagacggaaacgagaccctcggggaatcagacagc
gagggcgtctacgagctcacccaggacctccaccacagggaccacagggaccacagggac
agccgtcagcccaggaagaggcagcgaaagctgggtaccacggtggggagagtggtccga
gcctggaggctggtgtgtgatacctttaggaagatagtggacagcaagtattttggaaga
ggaatcatgatcgccattctgattaatacactgagtatggggattgagtaccacgaacag
cctgatgagctgaccaatgctttagagatcagtaacatagttttcaccagtctgtttgcc
ttggagatgttactcaaggtgttggtgtatgggccgtttggttacatcaaaaacccttac
aacatcttcgacggagtcatagtggtcatcagtgtatgggagatcgtgggccagcagggt
ggtggtctttctgtgttgcgtaccttcagactgatgcgcgtgttgaagctggtgcgcttc
atgcctgctctgcagagacagctggtggtgctgatgaagaccatggacaacgtggccacc
ttctgtatgctacttatgctcttcatcttcatcttcagtatattgggcatgcatctgttt
ggctgtaagtttggatcagagagagatggagacactctaccagacaggaagaactttgac
actctgctctgggccatcgtcaccgtgtttcagatcctaactcaggaggactggaacaag
gttctctataatggtatggcctccaccactcctgtggccgctctctacttcatcgccctc
atgacctttgggaactacgtcctcttcaaccttctggtggccatcttggtcgagggcttc
cagactgaggctccccctgtctctctaccctccacaaccccgctgcacgatgccacggct
gttgagactaaccaggttgacagtaaaggtgatatgggagtcaggctggccccggggtca
cggacatggtcccaaccaaggtcctggctgcatccacataggaggccccagctagggtcc
cttccatacaggccatactgggctgtccctctctctacagtggtctcaggggtctgggag
actcagctgggcccctggcctagtgttgggcccaccggagaagactccaagtcagtgtcg
gaggctgatttatcatcgaggagtatggaggacgtgaacggcagtggaaaggatgtgtct
ggctccccagtagtccctataaacggtcatgttgacctgaagaccagtctgacccctcct
ctgatcacccacactgctgccacccccatgcccgttcccaagctgcccgccgtggttgac
cctgctctgggctatgagtcccgacgcagcagcaacgtctccatggacctggactgctac
gacaagtctccgatcagtgcccatagcacctccccttacgccccgtggagctccacctct
ggctggaccagccgtagatcaagctggaacagcgtaggccgtgccccttcgctcaaacga
acaaagcgtcagtctggcgaacggcagtcgctcctctccggagagggtgggtccagttcg
gaggatgatgaggggggaggaggggggacattggagggggatgatgtgtccctgtgtcgt
accgactccatgtcccagtcccaacaccgacacaggaggatggagtctgtggagactagg
gggtccatagacctggcccctgacatactgctacaggtgcccttcctgtatcgctcagcc
agtatacatagctccagacccccctcgctaggaggcctgagagccccagaacactgtgac
tgtaacgggaaaggcactccggcccctaggggggccctggcccagacacagctctccctt
gaggacaacacagaggacgaagcagcagaggaggaggtcgtgggtcgttttgccaggctg
tcacgctggctggagaggaaacagcctgagtggtgtcgaaagagagatacctggtccctg
tacatattacccccagactccaggtttcgaatggcatgcaacaagataataacccacaag
atgtttgaccacatcgttctggtcatcatcttccttaactgcatcaccatcgccatggag
aggcctagaatagaggcatatagcgtggagcgcatcttcctcacattatccaactacata
ttcacagcgatctttgtggcagagatgactgtaaaggtggctgcgctgggctggttgttt
ggtgataaggcctacctgaggagtagctggaaccttctagacgggttgttggtgatgatc
tcagccatagacatccttgtctcattggtgtccaacagcagccccaagatactgggtatg
ctccgggtgctgcgcctgctacggacactcaggccactacgtgtgatcagcagggcccca
ggtctgaagctggtagtggagactctgatgtcatctctgaagcccatagggaacattgtg
gtcatctgctgcgccttcttcatcatctttggtatcctgggagtacagctcttcaagggg
aagttctttgcgtgtcagggagaggacgtgagaaacgtcactaacaagtcagactgcatg
atggccaactacaagtgggtcagacagcagtacaactttgacaacctggcacaggctctg
atgtctctgttcgtgctggcctctaaggatggttgggttgacatcatgtatgatggatta
gatgcagtgggagtcgaccaacagccgcagctgaaccacaacccctggatgctcctctac
ttcatctccttcctgctcatcgtcagcttcttcgtgctcaacatgttcgtgggtgtggtg
gtggagaacttccacaagtgtcgtcgcagccaggaggctgaggaggccaaacgcagggag
gagaagagactgaaacggatggagaaaaagagacggagtaaggagaaggagatggctgaa
gctcagagtaagccttactactcggattactcccccacacgtctcctgatccacaacatg
tgtacctcccagtatctggatctcttcattaccgttgtcattggactcaatgtcatcacc
atggcgatggaacactaccagcagcccaaggagttggatgaggcactgaggatctgtaac
tacatcttcaccctcgtcttcgtcctggagtctgtcttcaagctggtggccttcggcttc
cgacgcttcttcaaggacaggtggaaccagctggatctggccatagtgttgctgtccatc
atgggcatcactctggaggagattgaggtcaacgcatccctgcccatcaaccctactatc
atcaggatcatgagagtactgaggatagcaagagtgctgaagctactgaagatggcagtg
gggatgagagcgttgctggacacggtcatgcaggccctgcctcaggtggggaatctgggt
cttctcttcatgttgctcttctttatctttgcagcactgggagtggaattgtttggtgac
ctcatttgtgatgagctgcacccatgtgagggtttggggcgctatgctacgtttaagaac
tttggcatggccttcctgctgctgttcagagtttccacaggagacaactggaacggcatt
atgaaggataccctgcgagactgtcaacaggagaacgcaggcacctgttacaacaccgtg
gtctcccccatctacttcgtctcctttgtgttgacagcccagtttgtcctggtcaacgtg
gtcatagccgtcctcatgaagcacctggaggagagcaacaaagaggccaaagaggaggca
gagctggaggctgaactacagctggagctccagcatggagaagggggaggcagtgggaga
tcaccccagctaagccctctggacttgggcatggaggtgggcggacctggtgtgtccccc
tggaggtctccagagagggagatccagaggagggccagcgtgatggtggattctccccaa
acagatatcactacaagagacatcagctctgatcccctgctagtcctggagccaccactg
gagatggagttactcgatcctggggagccattggaggacaacctgctaagtgtacggaag
tcaatggtgggccgcacccactccctacccaatgacagctatatgttcctgcctctggag
cccttcggatccccaggagccagcctggcccctggtttagcctcacaaacacagactaca
ggaccacagcacatagagaccatcaacaaggccctgtcaggctcatgtacctcgctacgg
acccaaccagacgatagacccagcagttctcacagcctttcacactcccagagtatacac
acactcagccgcacgctccgcagacaggtggcaatatctaatgactcccaggaggtcctg
tgttctgatggaggggagggtgaggaggtagtcctccatgtagcttccctagccctctcc
tcctcctcttcctcgccctcccatcttcatcagcagcctgctctccagctggtccctgcc
accccaggggcatcccctcaatcgtcgcgccccagcagtgtccacacccagcacccctcc
tcccactccttaccccctcctccccttccccccactcgcccctggagacaggacgaggcc
tcggctgatcaggaagtgtcgctcatcaccagggcggggctggcagggattgacgatgtc
atcggggttggactggggtcagaggagggaggtctcgagggcagttacaaaggttactgg
gttggtcgtggtggggggcagttgaagaggttccacagtgctgacacccaggggcggagc
gtccttgcgccccggtcacgccccctgtcctggttggatgatcctcgccgccactcagtg
gaggagtgttcgtccgtagagtcaagcccccagcgcagcaccacgtcctcgaggttcgtc
tcccgagcagacagcctccagatccattcccagaccaccacacacaccctgccctctccc
cgacacaagaaaaaaatgagtcccccgtgtatctccgtagacccccctgatggactggag
ccccagtctggcctccaccctgccccggggggtttggggggcctagggatgccccctccc
ttacaaggccgggatacctcctgtctaaggagacgggcgccctccagtgactccaaggac
tcctttgacctaggggtaggggaggggctggggcttgggctgtgccaggagggaggtggg
tccaacaccaatcccaagctgttgactctgtcgagcttctcctttgagaaaacaagctct
gagtactga

DBGET integrated database retrieval system