KEGG   Salmo salar (Atlantic salmon): 106579262Help
Entry
106579262         CDS       T04363                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sasa01002]
    106579262
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106579262
   04090 CD molecules [BR:sasa04090]
    106579262
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     106579262
Peptidases [BR:sasa01002]
 Metallo Peptidases
  Family M2
   106579262
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106579262
CD molecules [BR:sasa04090]
 Proteins
  106579262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32 Gram_pos_anchor
Motif
Other DBs
NCBI-GeneID: 106579262
NCBI-ProteinID: XP_014014493
UniProt: A0A1S3NGB5
LinkDB All DBs
Position
ssa19
AA seq 1294 aa AA seqDB search
MARMLWGAVVVLLPLLGLCQFVLPPEWGPGTFPATEAGAKDFVTAYNTAAELVIYQNQEA
SWTYQTNITTHNAEKKVESDGMKQAFTEAWGKKVKDNFSPTVLATFNTTLQRLLKKINIL
GAANLPAGERNEYNVILSKMSEIYSTAKVCPKTNECWSIEPELTEIMANSRSYKTLLYAW
EGWHNASGVPLRAEYPKFVELSNKAYKTDGFDDTGAYWRSWYESKTFENDLEAIYKQVQP
LYQNLHAFVRRKLYDHYGPKYINLKGPIPAHLLGNMWSQTWNNIYGMMIPFPGKPNVDVT
NEMVAKNWNATHMFRVAEEFFTSLGLIKMPQDFWDKSMLEKPEGREVVCHASAWDFYNRK
DFRIKQCTTVNMQQLFTVHHEMGHVEYYLQYKEQPISFRRGANPGFHEAIGDVMSLSVST
PKHLSSIGLLSNATNDNESDINYLLKMALEKMAFLPFGYLIDQWRWSVFSGRTPPERYNA
DWWHLRTKYQGICPPTKRTEEHMDAGAKYHIPGNTPYIRYFVSFILQFQFHNKLCQAANQ
TGPLHTCDIYQSKEAGKMLETVLKSGESKPWEQVLQEAVGTNKIDASSLMEYFGPIITWL
EEQNAAMHETLGWPDFNWVPPIPEGYPEDIDMIADEVQAKNFLEEYNSTAEVVWNAYIEA
SWAYNTDINEKNRQNMLQKNLDMSNHTLTYGKEARKYDTTDFQDEAVKRILNKLGDIERA
GLPDEELKEYNNLLANMETKYSVAEVCRANGTCHPLDPDLQKIMAESRDYNELLFAWQGW
RNASGRELRQDYKRYVQLANKAAALNGHSDNGAFWRSLYETPSFEEDLERLWKELEPLYL
NVHAYVRRSLYRKYGGKHINLKGPIPAHLLGNMWAQTWSGIMDLAIPYPDATQVDATPAM
IAKGWNATRMFQESDNFFTSLGLLPMPPEFWAKSMLEKPNDGRNVVCHASAWDFYNRNDV
RIKQCTVITMDDLITVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVLALSVATPK
HLKEIGLLDVVEDNPESMINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRISQEEYNKEW
WNMRMKYQGLCPPVARTEQDFDPGAKFHIPANVPYVRYFVSFIIQFQFHQALCDATGHVG
PLHQCDIYRSKEAGKLLGDVMKLGFSKPWPEAMAMITGEPTMSAKPLVQYFKPLTDWLEA
ENNKNGEVRGWPEYDWKPPSDGSETSPSAPTPIPVLDNGKVNFLGMSLDGAAAAAGQWVL
LVLGLVLLVATILLGYKNKKSKRRDLTSSELELK
NT seq 3885 nt NT seq  +upstreamnt  +downstreamnt
atggccagaatgctttggggagcggtggttgtgctactgccactcttgggactctgtcaa
tttgtcctgccacctgagtggggaccagggaccttccctgccacagaggccggggccaag
gactttgtcactgcctacaataccgccgctgagctggtcatctaccaaaaccaagaggcc
agctggacataccagaccaacattacaacccacaacgctgagaaaaaggtggaatctgat
gggatgaagcaggccttcacagaagcctgggggaagaaggtcaaagataacttctctcct
actgtgttggccaccttcaacacgactcttcagaggcttctcaagaagatcaatatcctg
ggagcggctaacctacctgcaggagaaagaaatgagtacaacgtcatactaagcaagatg
tctgaaatatactctaccgccaaagtgtgtccaaagactaatgaatgctggtctattgag
ccagagctgacagagatcatggccaactcacggagctacaagacactgctgtatgcttgg
gagggttggcacaatgcatcgggtgtgccactcagggcagagtatccaaagtttgtggag
cttagcaacaaggcctataaaactgatggtttcgatgacactggagcatactggcgttcg
tggtacgagtcaaagacttttgagaatgacctggaggctatttacaaacaggtgcagccg
ctctaccagaatcttcacgcctttgtgcgccgcaagctctacgaccattacggaccgaaa
tacatcaatcttaaaggacctatccctgctcacctgctaggaaacatgtggtcgcaaacc
tggaataacatctatggcatgatgatccccttccccggcaaacccaatgtggacgtgacc
aatgaaatggtggccaaaaactggaatgctactcacatgttccgggtggctgaggagttt
ttcacctccctcggcctcatcaaaatgccccaagatttctgggacaagtctatgttggag
aagccagaaggtcgggaggtggtgtgtcatgcatctgcctgggacttctacaatagaaag
gacttcaggatcaaacagtgcaccacagtcaacatgcagcagcttttcacagtgcaccac
gagatgggccatgttgaatattacctgcagtacaaggaacaacctataagcttccgccgc
ggtgctaacccaggcttccacgaggccattggtgatgtcatgtccctctctgtgtccaca
cctaagcatctgtccagcatcggcctattgtctaacgcgaccaatgacaacgagagtgac
atcaactacctgctgaagatggctttggagaagatggccttccttccctttggctatctc
attgaccagtggagatggagtgtgtttagtgggcgcacccccccagagcgatacaacgca
gactggtggcacctcaggacaaaataccagggtatatgtcctcccaccaaacgcacagag
gagcacatggacgctggagcgaaatatcacattccaggaaacaccccatacatcaggtac
tttgtgagcttcattctgcagttccagttccacaataagctgtgtcaggcagccaatcag
acaggacccctgcacacatgtgacatctaccagtccaaggaggcgggaaaaatgttagag
acagtccttaaatccggagaatccaagccctgggaacaggtgctccaggaagccgtcggg
acaaacaagattgacgccagctccctgatggaatactttggtcccatcatcacatggttg
gaggaacagaatgcagcaatgcatgagaccttgggctggcctgactttaactgggttcca
cccataccagagggctaccccgaggatattgacatgattgcagatgaggtgcaggcgaag
aatttcctggaggagtacaacagcactgcggaagtggtctggaatgcctacattgaggca
tcgtgggcctacaacactgatatcaatgagaagaacaggcagaacatgctgcagaagaat
ttggacatgtctaaccacacactgacctacggaaaggaggcccgcaagtatgacaccaca
gacttccaggatgaggccgtgaagcgtatcttgaataaactcggtgacattgaaagggcc
ggacttcccgacgaggaactgaaagagtacaacaatttgctggccaacatggagaccaag
tacagtgtggctgaggtgtgcagagccaatgggacctgccatccactggacccagacctc
cagaagatcatggctgagtccagagactacaatgagctgttgttcgcctggcagggctgg
agaaatgcctctggcagagaactgcgacaggactacaagagatatgtgcaactggccaac
aaagctgccgctcttaacggacactctgacaatggggcgttctggcgctccctgtacgag
accccctcctttgaagaggatctggagcgtctgtggaaggagctggagcccctctatctc
aatgtgcacgcctatgtgcgcaggtctctctacaggaagtatggaggcaaacacatcaac
ctgaagggacccatccctgcccatcttctaggcaacatgtgggcgcagacctggtctggc
atcatggacttggccattccgtaccccgatgccacacaagtagacgccacaccagccatg
atagccaagggctggaatgccaccaggatgttccaagagtcagacaacttcttcacttct
ctggggctattgcccatgcctccagagttctgggccaagtccatgctagagaaacccaat
gatggacgcaacgtggtatgccatgcctccgcctgggacttctacaaccgcaacgacgtc
aggatcaaacagtgcaccgtgataaccatggatgacctcatcaccgtgcaccatgagatg
ggtcatgtgcagtacttcctgcagtacaaggaccaacctatttccttccgcgacggcgcc
aacccaggcttccacgaggccattggtgatgtgctggccctgtccgtcgccactcccaag
catctaaaggagattggtttactggatgtggtggaggacaacccagagagtatgatcaat
tacctcatgagcatcgccctggacaaaattgccttcctgcccttcggttacttgatggac
cagtggaggtggaaagtgtttgatggacgcatctctcaagaggagtacaacaaggaatgg
tggaacatgagaatgaagtaccagggcttgtgtccacctgtggcccgcactgagcaggac
tttgacccaggtgcaaagttccacatccctgctaatgtgccctatgtcaggtacttcgtg
agcttcatcatccagttccagtttcatcaggctctgtgtgacgccaccggacatgtaggc
cctctccaccaatgtgatatctatcgctccaaagaggcagggaaacttctaggtgacgtg
atgaagctgggttttagtaagccctggcctgaagcgatggctatgatcactggagagcct
accatgtccgccaagccactggtacagtacttcaaacctctcactgattggctggaggca
gagaacaacaagaatggcgaggtcagaggctggcctgaatatgactggaaaccaccaagt
gacggctcagaaacatccccctcagccccaaccccaatcccagttctagataatggtaaa
gtgaactttctgggcatgagtctggatggtgcagcggctgcagcaggccagtgggtccta
ctggtcctgggcctggtgctcctagtggccaccatcctcctgggctacaagaacaagaaa
tcaaaacgaagagatctgacctcatctgagctggagctgaagtaa

DBGET integrated database retrieval system