KEGG   Salmo salar (Atlantic salmon): 106579424
Entry
106579424         CDS       T04363                                 

Definition
(RefSeq) brain-specific angiogenesis inhibitor 1-like
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106579424
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106579424
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106579424
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sasa04030]
    106579424
Peptidases and inhibitors [BR:sasa01002]
 Mixed peptidases
  Family P2
   106579424
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Phagocytosis
   Others
    106579424
G protein-coupled receptors [BR:sasa04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   106579424
SSDB
Motif
Pfam: AGRB_N 7tm_2 TSP_1 GAIN TSP1_spondin GPS TSP1_ADAMTS TSP1_CCN
Other DBs
NCBI-GeneID: 106579424
NCBI-ProteinID: XP_014014798
UniProt: A0A1S3NHA6
LinkDB
Position
ssa02
AA seq 1622 aa
MTTTLFSSLPGHLVNPQVPLSSSLLLLLLLQLFSQCPAAPSGPESDTCSTLVQSRFFGHF
LSSSTFPTAPCSWTLQNPDPRRYTIFIKVTKPTSTTDCIPRQLRTFQFDSFLETTRTYLG
MESFDEVVKLCESSSPVAFLEAGKQFLQMRKGPPRAGVTVTTPNAGEDGEFKTEYLVVGK
RNPSMAACQMLCQWLEDCLASSTSNRPCGIMQTPCQCWEPPPPQLSEGDGCYRNGFYLEN
CLPSSNEKSDTDSNGGWSVWAEWAECSSDCGGGVQTRSRTCQSPPEETYLCEGVVEEGRP
CNPQPCSGKGRHLTRSQSLRSVDSRKRDGGGGEVDKTRGGGGGQQAPQTVDQAVSGEEWS
SWSVCSATCGESWQSRTRFCVSSSYSTQCSGPLREQRPCNNSAVCPAALIAVHGTWDEWS
PWSLCSSTCGRGYRDRTRSCKPPQFGGDPCMGPEKQTKFCNIAVCPVDGVWNEWANWGSC
SASCSNGTMQRIRECNGPSYGGSECRGEWIETRDCFIRECPVEGKWHPWTSWVGCTKTCG
GGSQQRQRICYGPFFGGENCPGDREEVRRCNEKRCPEPHEICAEENFSNVVWKMTPAGDT
AAVRCPPNANGLILRRCTLDDEGIAYWENPTYMKCISNDYRSIQTLTREHLSKAQRGLVG
DGVSEVMTKLRVTTSDGTSYSGDLLAIVDVLKNMTEIFRRAYNSPSNADMRNFVQSVSNL
LMEENRERWEEAQLLGPNIKELFRLVEDFVDVYGLRMKDFQDMVEVTDNLVLSIHKRPVA
GNADISFPMKGWKGMMDWARSSEDRVTVSKNILSTGKPDADDLSAFVTGIVLYRNLGSIL
SLQRNSTVLNSKVVSVTIKPTPGSLSTPVEVQFSHLYNGTTNQTCISWDESDSSSLLGSW
SARGCRAVPVDSFSTKCVCDRLSTFAILARLNPDMNMDKMQLPSVTLMVGCGVSSLTLLL
LIIIYVSVWRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVICTLVAAFLHFFFLS
SFCWVLTEAWQSYMAVTGRLRNRIIRKRFLCLGWGLPALVVAVSVGFTKAKGYGTVNYCW
LSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDMKLKERAGQMTVPLYNMTL
KCAKCGVISSADVSTTATSNAMASLWSSCVVLPLLALTWMSAVLAITDRRSSLFQILFAV
FDSLEGFVIVMVHCILRREVQEAVKCRVVDRQEDGNGDSGGSFQNGHAQLMTDFEKDVDM
ACRGGTLKRSSLQGDEKPSSQPLTLQKGSNFNTMPASMAKVHLQNVADYPSHTLTLRREK
GGTTKGISTELPGAKSIYICDGELFKQLDGELSPQGTGEAGGPEGTGTGPGTGYIILPNN
NNTGTLGRPGKGSKEDTTAKYNISIEQQMPQTRLIHLANSAGVEGVPGFALKSLPADLVS
VSCSERESPVHNMQNVSGESHMTNSMCEQGDSGNSGMMSKSETVSTLSMSSLERRKSRYA
ELDFEKIMHTRKRHQDMFQDLNRKIHSADQDRASPPGDGKAGKRWSVSSAGSDKTITSDK
QQTPSKRAWEGIRKTQSPPSWMRKDLEPLAASPLELQNVEWEKASATIPLVGQELMDLQT
EV
NT seq 4869 nt   +upstreamnt  +downstreamnt
atgacgaccactcttttttcctccttacctgggcacctggtgaacccccaagtccccctg
tcatcatcgttgctgcttttgctgctgttacaactatttagtcagtgcccggctgctccc
tcagggcctgagtcagacacctgctccactctggtccagagccgattcttcggccacttc
ctgtcctcctccactttccccacggcaccctgctcctggaccctgcagaacccagacccg
cggcgctacaccatctttatcaaggtaaccaaacctacctccacaacggactgcattccc
cggcagctccgcacattccagtttgactcgtttctggagaccacgcgcacctacctgggc
atggagagcttcgacgaggtggtcaagctgtgtgaatcttcatcccctgtggcctttctg
gaggctgggaaacagttcctacaaatgaggaaagggccaccccgggccggcgtgacggtc
accacccctaacgctggcgaagatggggaatttaagacagagtacctggtggtgggtaag
cgtaaccccagcatggcagcatgtcagatgctgtgccagtggctggaggactgcctggca
tccagcacctctaacaggccctgtggcatcatgcagaccccctgccagtgctgggagccc
cctcctccacagctcagcgaaggggatggatgctacaggaacgggttctacctggagaac
tgcctacccagctccaatgagaagagtgatactgacagcaacggtggctggagtgtgtgg
gcggagtgggcggagtgcagcagtgactgtggtggtggcgttcagacccggagccgtacc
tgtcaatctcccccggaggagacatacctgtgtgagggagtagtggaggagggaaggccc
tgtaaccctcagccctgcagtggcaaaggccgtcatctcactcgcagccaatcacttcgc
tccgtggacagccgcaagcgcgatggcggcggtggcgaggtagacaagacacgaggcggt
ggcggcggacagcaggccccacagacagtggaccaggctgtgtcaggtgaggagtggtcg
tcgtggagtgtgtgttcggccacatgcggtgagagctggcagagccgcacgcgtttctgt
gtctcctcctcctacagcacccagtgtagcggcccactccgagagcagaggccctgcaac
aactctgccgtctgtccagccgctctgattgcagtgcatgggacttgggatgagtggtca
ccatggagcttgtgttcgtcaacctgcggccgtggttaccgggatcgtacgcgcagctgc
aagccccctcagtttgggggagacccctgtatggggccggagaagcagaccaagttctgc
aacatcgctgtctgcccagttgatggggtgtggaatgagtgggctaattggggttcatgc
tctgcatcctgctccaacgggaccatgcagcggatcagggagtgtaacggaccttcgtac
ggaggatcagagtgtcgcggggagtggatagagaccagagactgcttcatacgggagtgc
ccagtggaggggaagtggcatccttggacgtcgtgggtgggctgcactaagacatgtggc
ggggggagccaacagagacagaggatttgctatgggcccttctttgggggcgaaaattgt
cctggagatcgagaggaggtgcgacgctgcaatgagaagcggtgtccagaacctcatgag
atctgtgcagaggagaacttctccaacgtagtgtggaaaatgactccagcaggggacaca
gcggccgtacgctgccctcccaatgccaatgggctgatcctgaggcggtgcaccctggat
gatgagggaatagcctactgggagaaccccacttatatgaagtgtatctccaacgactac
cgcagcatccaaacactgactcgggaacacctgtccaaggcccagcgggggcttgtgggg
gatggagtttcagaggtgatgaccaagctcagggtgacaaccagcgatgggaccagctac
agtggagacttgctggccatagtggacgtactgaagaacatgacagagatcttcagaagg
gcctacaacagccccagcaatgcagacatgagaaactttgtccagtcagtcagtaacctg
ctgatggaggagaacagagagagatgggaagaagcacaactgttgggtcctaacatcaag
gagctgttccggttggtggaagactttgtggacgtctacggtcttaggatgaaagacttc
caggatatggtcgaggtcacggataacttagttctgtccatccacaagcgtccggtggcg
ggtaatgcagacatcagcttccctatgaagggctggaaggggatgatggactgggcccgc
agctctgaggacagagttactgtctccaagaacatcctctccacaggcaagccagatgca
gatgacttgtcagcgtttgtcaccgggatcgttctctacagaaacctgggcagcatccta
tctctacagagaaacagcaccgtgctcaactccaaggtggtgtctgtgaccatcaagccc
accccaggatccctctctaccccggtggaggtccagttctcacacctttacaacggcacc
acaaaccagacctgcatctcctgggacgagagtgacagctcttcgctgctcggatcgtgg
tctgccaggggctgcagagccgtgcctgtcgactcattcagcaccaaatgcgtgtgtgac
agactctcaaccttcgccattttagcacggctaaatcctgacatgaacatggataaaatg
cagcttccctctgtgacgctgatggtgggctgtggagtctcctctctcaccttgctgctc
ctcatcatcatctatgtgtcggtctggaggtacattcgctccgagcgctccgtcatcctc
atcaacttctgcctctccatcatctcctcaaacgccctcatcctcattggtcagacacag
acacggaacaaggtgatctgcacgctggtcgctgctttcctgcatttcttcttcctgtcg
tcgttctgttgggttctgacagaggcgtggcagtcatacatggccgtgactggccggctg
aggaaccgcatcatccgcaagcgattcctgtgtctgggctggggtctaccggctctggtt
gtggcagtctctgtgggtttcaccaaagctaagggatatggcaccgtcaactactgctgg
ctgtctctggaaggtggtctgctttatgcgtttgtgggaccggctgccgctgtagtcttg
gttaacatggttatcgggattctcgtatttaacaaactggtgtccaaagacggcattact
gatatgaaactgaaggagagggcaggtcagatgacagtaccactgtacaatatgacgctc
aaatgtgccaagtgcggagttatctcgtcggctgacgtttctaccacagctaccagtaac
gccatggcgtcgctgtggagctcctgtgtggttctgcctctcctggccctcacctggatg
tctgctgtcctggccatcaccgaccgacgctcctccctcttccagatcctgttcgctgtg
tttgattcgctggaaggcttcgtcatcgtcatggtgcattgcatcctgcgccgagaggtt
caagaggcagtgaagtgtcgggtagtggaccgccaggaggacgggaatggagactcaggg
ggatctttccagaacggacacgctcagcttatgactgattttgagaaagacgtcgacatg
gcttgcagaggaggtactctgaagcgttcctctctccagggtgatgagaagccatcctcc
cagcccctgacccttcagaagggctctaacttcaacaccatgcctgccagcatggccaaa
gtccacctccagaatgtggcagactaccccagtcataccctcaccctgcgaagggagaag
ggtggcaccaccaagggaatcagcaccgagctgccaggagccaagtccatctacatctgt
gacggggagctctttaaacagctggacggggagctgtctccacagggaacaggggaggcc
gggggccctgagggcacaggaacaggcccgggcacaggatacatcatcctgcctaacaac
aacaacaccggcaccctggggcggcccggaaagggcagcaaggaggacacgacggccaag
tacaacatcagcatcgagcagcagatgccccagaccaggctcatccacctggccaactcg
gcgggggtggagggcgtcccgggtttcgcgctgaagagcctgcctgcggacctggtcagt
gtctcctgctcggagagggagtcgcccgtccacaacatgcagaacgtctccggagaatcc
cacatgaccaacagcatgtgtgaacagggtgattctgggaactctggaatgatgtccaag
agcgagaccgtgtccactctctccatgagctccctggagagacgaaaatctcgctatgcg
gagctggactttgagaagatcatgcacacacggaagcgtcaccaggacatgttccaggac
ctgaacaggaagatccacagtgcagaccaggacagggcgtctccgcctggcgatgggaag
gcagggaagaggtggagtgtgtcctcagcaggcagcgacaagaccatcacgagcgacaag
cagcagacacccagtaagagagcctgggagggcatcaggaagacccaatctcccccgtcg
tggatgaggaaggacctggagcccttggcggcctctcccctggagttgcagaacgtggag
tgggagaaggccagcgccaccatccctctggtgggacaggagctcatggacctgcagaca
gaggtgtga

KEGG   Salmo salar (Atlantic salmon): 106605503
Entry
106605503         CDS       T04363                                 

Definition
(RefSeq) brain-specific angiogenesis inhibitor 1-like
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106605503
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106605503
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106605503
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sasa04030]
    106605503
Peptidases and inhibitors [BR:sasa01002]
 Mixed peptidases
  Family P2
   106605503
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Phagocytosis
   Others
    106605503
G protein-coupled receptors [BR:sasa04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   106605503
SSDB
Motif
Pfam: AGRB_N 7tm_2 TSP_1 GAIN TSP1_spondin TSP1_ADAMTS GPS TSP1_CCN
Other DBs
NCBI-GeneID: 106605503
NCBI-ProteinID: XP_014056706
UniProt: A0A1S3RWS1
LinkDB
Position
ssa05
AA seq 1631 aa
MTTTLFTSLSGHLVNLQVPLPSSLMLLLLIQLFSRCPAAPSGPESDTCSTLIQSRFFGHF
LSSSTFPTAPCSWTLQNPDPRRYTIFIKVTKPTSTTDCIPRQLRIFQFDSFLETTRTYLG
MESFDEVVKLCDSSSPVAFLEAGKQFLQMRKGPPRAGMEVTTPNASENGEFKTEYLVVGK
RNPSMAACQMLCQWLEDCLASSTSNRPCGIMQTPCQCWEPPPPPQLSEGDGCYRNGFYLE
NCLPSSNEKSDTDSNGGWSVWAEWAECSSDCGGGVQTRSRTCQSPPEETYLCEGVVEEGR
PCNPQPCSGKGRHLSRSQSLRSVDSRKRDGGGGEVDKTRGGGGGQQAPQTVDQAVSGEEW
SSWSVCSATCGEGWQSRTRFCVSSSYSTQCSGTLREQRPCNNSAVCPAALIAVHGTWDEW
SPWSLCSSTCGRGYRDRTRSCKPPQFGGDPCMGPEKQTKFCNIAVCPVDGVWNEWANWGS
CSASCSNGTMQRIRECNGPSYGGSECRGEWIETRDCFLRECPVEGKWHPWTSWVGCTKTC
GGGSQQRQRICYGPFFGGENCPGDREEVRRCNEKRCPEPHEICAEENFSNVVWKMTPAGD
TAAVRCPPNANGLILRRCTLDDEGIAYWENPTYMKCISNDYRSIQTLTREHLSKAQRGLV
GDGVSEVMTKLRVTSSDGTSYSGDLLAIVDVLKNMTEIFRRAYNSPSNADMRNFVQSVSN
LLMEENRERWEEAQLLGPNIKELFRLVEDFVDVYGLRMKDFQDMVEVTDNLVLSIHKRPV
AGNADISFPMKGWKGMMDWARSSEDRVTVSKNILSTGKPDADDLSAFVTGIVLYRNLGSI
LSLQRNSTVLNSKVVSVTIKPTPGSLSTPVEVQFSHLYNGTTNQTCISWDESDSSSLLGS
WSARGCRAVPVDSFSTKCVCDRLSTFAILARLNPDMNMDKMQLPSVTLMVGCGVSSLTLL
LLIIIYVSVWRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVICTLVAAFLHFFFL
SSFCWVLTEAWQSYMAVTGRLRNRIIRKRFLCLGWGLPALVVAVSVGFTKAKGYGTVNYC
WLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDMKLKERAGQMTVPLYNMT
LKCAKCGVISSADVSTTATSNAMASLWSSCVVLPLLALTWMSAVLAITDRRSSLFQILFA
VFDSLEGFVIVMVHCILRREVQEAVKCRVVDRQEDGNGDSGGSFQNGHAQLMTDFEKDVD
MACRGGKSTGKKKSTLKRSSLQGDEKPSSQPLTLQKGSNFNTMPASMAKVHLQNVADYPS
HTLTLRREKGGTTKGISTELPGAKSIYICDGELFKQLDGELSPRGTGEAGGPEGTGTGPG
PGYILLPNNNNTGTLGRPGKGSKEDTTAKYNISIEQQMPQTRLIHLANSAGVEGVPGFAL
KSLPADLVSVSCSERESPIHNMQNVSGESHMTNSMCEQGDSGNSGMMSKSETVSTLSMSS
LERRKSRYAELDFEKIMHTRKRHQDMFQDLNRKIHSADQDRASPPGDGKAGKRWSVSSAG
SDKTIMSDKQQTPSKRAWEGIRKTQSPPSWMRKDLEPLAASPLELQNVEWEKASATIPLV
GQEIMDLQTEV
NT seq 4896 nt   +upstreamnt  +downstreamnt
atgacgaccactctttttacctccttatctgggcacctggtgaacctccaagtccccctg
ccatcatcgttgatgcttctgctgctgatacaactgtttagtcggtgcccggctgctccc
tcagggcctgagtcagacacctgctccactctgatccagagccgattcttcggccacttc
ctgtcctcctccactttccccacggcaccctgctcctggaccctgcagaacccagacccg
cgccgctacaccatctttatcaaggtaaccaaacctacctccacaacggactgcattccc
cggcagctccgcatattccagtttgactcgtttctggagaccacgcgcacctacctgggc
atggagagcttcgacgaggtggtcaagctgtgtgactcttcatcacctgtggcctttcta
gaggctgggaagcagttcctacaaatgagaaaagggccgcctcgggccggcatggaggtc
accacccctaacgctagcgaaaatggggaatttaagacagaatacctggtggtggggaag
cgtaaccccagcatggcagcatgtcagatgctgtgccagtggctggaggactgcctggca
tccagcacctctaacaggccctgtggcatcatgcagaccccctgccagtgctgggagccc
cctcctcctccacagctcagcgaaggggatggatgctacaggaacgggttctacctggag
aactgcctacccagctccaatgagaagagtgatactgacagcaacggtggctggagtgtg
tgggcggagtgggcggagtgcagcagtgactgtggtggtggcgttcagacccggagccgt
acctgtcaatctcccccagaggagacatacctgtgtgagggagtagtggaggagggaagg
ccctgtaaccctcagccctgcagtggcaaaggccgtcatctctctcgcagccaatcactt
cgctccgtggacagccgcaagcgcgatggcggcggtggcgaggtagacaagacgcggggc
ggtggcggcggacagcaggccccacagacagtggaccaggctgtgtcaggtgaggagtgg
tcgtcgtggagtgtgtgttcggccacgtgcggtgagggctggcagagccgcacgcgtttc
tgtgtctcctcctcctacagcacccagtgcagcggcacgctccgagagcagaggccctgc
aacaactctgccgtctgtccagccgctctgattgcagtgcacgggacttgggacgagtgg
tcgccatggagcttgtgttcgtcaacctgcggccgtggttaccgggatcgcacccgaagc
tgcaagccccctcagtttgggggagacccctgtatggggccggagaaacagaccaagttc
tgcaacatcgctgtctgcccagttgatggagtgtggaatgagtgggctaattggggttca
tgctctgcgtcctgctccaacgggaccatgcagcggatcagggagtgtaacggaccttcg
tacggaggatcagagtgtcgcggggagtggatagagaccagagactgcttcctacgggag
tgcccagtggaggggaagtggcatccttggacgtcgtgggtgggctgcaccaagacatgt
ggcggggggagccaacagagacagaggatttgctatgggcccttctttgggggtgaaaat
tgtcctggagatcgagaggaggtgcgacgctgcaatgagaagaggtgtccagagcctcat
gagatctgtgcagaagagaacttctccaacgtagtgtggaaaatgactccagcaggggac
acagcggccgtacgctgccctcccaatgccaatgggctgatcctgaggcggtgcaccctg
gatgatgagggaatagcctactgggagaaccccacttatatgaagtgtatctccaacgac
taccgcagcatccaaacactgactcgggaacacctgtccaaagcccagcgagggcttgtg
ggggatggagtttcagaggtgatgaccaagctcagggtgacgtccagcgatgggaccagc
tacagtggagacctgctggccatagtggacgtactgaagaacatgacagagatcttcaga
agggcctacaacagccccagcaatgcagacatgagaaactttgtccagtcagtcagtaac
ctgctgatggaggagaacagagagagatgggaagaagcacaactgttgggtcctaacatc
aaggagctgttccggttggtggaagactttgtggacgtctacggtcttaggatgaaagac
ttccaggacatggtcgaggtcacggataacttagttctgtccatccacaagcgtccggtg
gcgggtaatgcagacatcagcttccctatgaagggctggaaggggatgatggactgggcc
cgcagctctgaggacagagttactgtctccaagaacatcctctccacaggaaagccagat
gcagatgacttgtcagcgtttgtcaccgggatcgttctctacagaaacctgggcagcatc
ctatctctacagagaaacagcactgtgctcaactccaaggtggtgtctgtgaccatcaag
cccaccccaggatccctctctaccccggtggaggtccagttctcacacctttacaacggc
accacaaaccagacctgcatctcctgggacgagagtgacagctcctcgctgctcggatcg
tggtctgccaggggttgcagagccgtgcctgtcgactcattcagcaccaaatgcgtgtgt
gacagactctctaccttcgccattttagcacggctaaatcctgacatgaacatggataaa
atgcagcttccctctgtgacgctgatggtgggctgtggagtctcctctctcaccttgctg
ctcctcatcatcatctatgtgtcggtctggaggtacattcgctccgagcgctccgtcatc
ctcatcaacttctgcctctccatcatctcctccaacgccctcatcctcattggtcagacg
cagacacggaacaaggtgatctgcacgctggtcgctgctttcctgcatttcttcttcctg
tcgtcgttctgttgggttctgacagaggcgtggcagtcatacatggccgtcactggccgg
cttaggaaccgcatcatccgcaagcgattcctgtgtctgggctggggtctaccggctctg
gttgtggcagtctctgtgggtttcaccaaagctaagggatatggcaccgtcaactactgc
tggctgtctctggaaggtggtctgctttatgcgtttgtgggaccggctgccgctgtagtc
ttggttaacatggttatcgggattctcgtatttaacaaactggtgtccaaagacggcatt
actgatatgaaactgaaggagagggcaggtcagatgacagtaccactgtacaatatgacg
ctcaaatgtgccaagtgcggagttatctcgtcggctgacgtttctaccacagctaccagt
aacgccatggcgtcgctgtggagctcctgtgtggttctgcctctcctggccctcacctgg
atgtctgctgtcctggccatcaccgaccgacgctcctccctcttccagatcttgttcgct
gtgtttgattcgctggaaggcttcgtcatcgtcatggtgcattgcatcctgcgcagagag
gttcaagaggcagtgaagtgtcgggtagtggaccgccaggaggacgggaatggagactca
gggggatctttccagaacggacacgctcaacttatgactgatttcgagaaagacgtcgac
atggcttgcagaggaggtaagagtaccggcaaaaaaaagagtactctgaagcgttcctct
ctccagggtgatgagaagccatcctcccagcccctgacccttcagaagggctctaacttc
aacaccatgcctgccagcatggccaaggtccacctccagaatgtggcagactaccccagt
cataccctcaccctgcgcagggagaagggtggcaccaccaagggcatcagcaccgagctg
ccgggagccaagtccatctacatctgtgacggggagctctttaaacagctggacggggag
ctgtctccacgagggacaggggaggccggggggcctgagggcacaggaacaggcccggga
ccagggtacatcctcctgcctaacaacaacaacactggcaccctggggcggcccggaaag
ggcagcaaggaggacacgacggccaagtacaacatcagcatcgagcagcagatgccccag
accaggctcatccacctggccaactcggcgggggtggagggcgtcccgggtttcgcgctg
aagagcctgcctgcggacctggtcagtgtctcctgctcggagagggagtcgcccatccac
aacatgcagaacgtctccggagaatcccacatgaccaacagcatgtgtgaacagggtgat
tctgggaactctggaatgatgtccaagagcgagaccgtgtccacgctctccatgagctcc
ctggagagacgaaaatcccgctacgcggagctggattttgagaagatcatgcacacacgg
aagcgtcaccaggacatgttccaggacctgaacaggaagatccacagtgcagaccaggac
agggcgtctccgcctggcgatgggaaggcagggaagaggtggagtgtgtcctcagcaggg
agcgacaagaccatcatgagcgacaagcagcagacacccagtaagagagcctgggagggc
atcaggaagacccaatctcccccatcatggatgaggaaggacctggagcccttggcggcc
tctcccctggagctgcagaacgtggagtgggagaaggccagcgccaccatccctctggtg
ggacaggagatcatggacctgcagacagaggtgtga

DBGET integrated database retrieval system