KEGG   Salmo salar (Atlantic salmon): 106580048
Entry
106580048         CDS       T04363                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 2-like
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04144  Endocytosis
sasa04218  Cellular senescence
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    106580048
   04371 Apelin signaling pathway
    106580048
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106580048
  09143 Cell growth and death
   04110 Cell cycle
    106580048
   04218 Cellular senescence
    106580048
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 106580048
NCBI-ProteinID: XP_014016087
UniProt: A0A1S3NL12
LinkDB
Position
ssa20
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSASGPGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGQLDE
LEKAITTQNCNTKCVTIPSNCSEIWGLSTPNTIEQWDTSGLYSYTDQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELRAIEACEYAFHLKKDEVCINPYHYQRVETPVLPPVLV
PRHSEILTELPPLDDYTHSIPENTSFPAGIEPPNNYIPETPPPGYISEDGEASDQPMNQS
MDTGSPAELSPGTLSPVNHSMDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcctccatcttgcctttcacccctccggtcgtgaagaggctcctggggtggaagaag
tcagccagcggccccgggggagcagggggtggagaacagaatggccaggaggagaagtgg
tgtgagaaggctgtcaagagcctggttaagaagctgaagaagactggacagctggatgag
ctggagaaggccatcaccacccagaactgcaacaccaagtgtgtcaccatccccagcaat
tgctctgaaatatggggactgagtacaccaaatacgatagaacagtgggatacctcaggc
ctatacagctacactgaccaaaccagatccctggatgggcgcctgcaggtctcccacaga
aagggtcttcctcatgtcatctactgccgcttgtggcgatggcccgacctgcacagccac
catgaactgcgtgccatcgaggcctgcgagtacgccttccacctcaagaaggatgaggtc
tgcatcaacccctaccactaccagagggtggagaccccagttctgcctcctgtacttgtg
ccaagacactcggaaattctgacagaactgcccccattggatgactacactcattccata
cctgagaacacaagctttcctgcggggatcgagcctccaaataactacataccagaaaca
ccaccacctggatacataagtgaggatggagaagccagcgatcaaccgatgaatcaaagt
atggacacaggttctcctgctgaattgtcccccggcaccctctcacctgtcaatcatagc
atggacctgcagccggtgacctactctgagcctgcgttctggtgctctatagcctactat
gagctgaaccagcgtgttggagagacattccacgcttcacagccctctctgaccgtggat
ggtttcacagacccctccaactcagagcgtttctgtctgggcctgctctccaacgtcaac
aggaatgccactgtagagatgaccaggaggcacataggaagaggagtccggctgtactat
attggcggtgaggtgtttgctgagtgtctcagtgatagcgccatctttgttcagagtcca
aactgcaaccagcggtatgggtggcacccagcaaccgtttgcaaaattcctccaggttgt
aacctgaagatcttcaacaaccaggagtttgcagcactgctggcccagtccgtaaaccag
ggctttgaggctgtgtaccagctcacccggatgtgcaccatccgcatgagctttgtcaaa
ggctggggggctgaatacagacggcagactgtcacaagcactccctgctggattgagctg
catttgaatggacccctgcaatggctggacaaagtgttgactcagatgggttccccttct
gtacgttgctccagtatgtcataa

KEGG   Salmo salar (Atlantic salmon): 106585370
Entry
106585370         CDS       T04363                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04144  Endocytosis
sasa04218  Cellular senescence
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    106585370
   04371 Apelin signaling pathway
    106585370
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106585370
  09143 Cell growth and death
   04110 Cell cycle
    106585370
   04218 Cellular senescence
    106585370
SSDB
Motif
Pfam: MH2 MH1 IRF-3 BNR_4
Other DBs
NCBI-GeneID: 106585370
NCBI-ProteinID: XP_014026965
UniProt: A0A1S3PH18
LinkDB
Position
ssa24
AA seq 464 aa
MSSILPFTPPVVKRLLGWKKSASGAGGGEQNSQEEKWCEKAVKSLVKKLKKTGQLDELEK
AITTQNCNTKCVTIPSNCSEIWGLSTPNTIEQWDTSGLYSYPDQTRSLDGRLQVSHRKGL
PHVIYCRLWRWPDLHSHHELRAIEACEYAFHLKKDEVCINPYHYQRVETPVLPPVLVPRH
SEILTELPPLDDYTHSIPENTNFPAGIEPPNNYIPETPPPGYISEDGEASDQPMNQSMDT
GSPADLSPGTLSPVNHSMDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFT
DPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCN
QRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWG
AEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgtcctccatcttgcctttcacccctccagtagttaagaggctcctggggtggaagaag
tcagccagtggcgctgggggaggagagcagaacagccaggaggagaagtggtgtgagaag
gctgtcaagagcctggtgaagaagctgaagaagactggacagctggatgagctggagaag
gccatcaccacccagaactgcaacaccaagtgtgtcaccatccccagcaattgctctgaa
atatggggactgagtacaccaaatacgatagaacagtgggatacctcaggcctatacagc
taccctgaccaaaccagatccctggatgggcgcctgcaggtctcacacagaaagggtctt
cctcatgtcatctactgccgcttgtggcgatggcctgacctgcacagccaccatgagctg
cgtgccatcgaggcctgcgagtacgccttccacctcaagaaggatgaggtctgcatcaac
ccctaccactaccagagggtggagaccccagttctgccacctgtccttgtgccaagacac
tcggaaattctgacagaactgcccccattggatgactacactcattccatacctgagaac
acaaactttcctgcagggatcgagcctccaaataactacataccagaaacgccaccacct
ggatacataagtgaggatggggaagccagcgatcaaccgatgaatcaaagtatggacaca
ggttctcctgctgatttgtcccctggcaccctctcacctgtcaatcatagcatggacctg
cagccggtgacctactctgagcctgcgttctggtgctctatagcttactatgagctgaac
cagcgtgttggagagaccttccacgcctcacagccctctctgacagtggacggttttaca
gacccttccaactcagagcgtttctgtctgggcctgctctccaacgtcaacaggaacgcc
actgttgagatgaccaggaggcatataggacgaggagtcaggttgtattatattggtggt
gaggtgtttgctgagtgtctcagtgatagcgccatctttgttcaaagtccaaactgcaac
cagcggtatgggtggcacccagcaaccgtgtgcaaaatccctccaggttgtaacctgaag
atcttcaacaaccaggagtttgccgccctgctggcacagtccgtgaaccagggctttgag
gcagtgtaccagctcaccaggatgtgcaccatccgcatgagttttgtcaaaggctggggg
gctgaatacagacggcagactgtcacaagcactccctgctggattgaactgcatttgaat
ggacctctgcaatggctggacaaagtgttgactcagatgggttccccttctgtacgctgc
tccagtatgtcataa

DBGET integrated database retrieval system