KEGG   Salmo salar (Atlantic salmon): 106580050
Entry
106580050         CDS       T04363                                 

Definition
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1-like
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106580050
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106580050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sasa04121]
    106580050
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106580050
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    106580050
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-C3HC4_2 Prok-RING_4 zf-RING_11 zf-RING_4
Other DBs
NCBI-GeneID: 106580050
NCBI-ProteinID: XP_014016091
UniProt: A0A1S3NLK8
LinkDB
Position
ssa20
AA seq 265 aa
MASLVGCEHYVRSCLLKAPCCGKAYVCRLCHDAEEDHQMDRFLVKEVQCSVCTTVQQAQQ
NCVECNVTFGEYYCDICHLFDKDKKQYHCQPCGICRIGPREKYFHCEKCNLCLAGDLRGN
HKCVENVSRQNCPVCMEDIHTSRIGAQILPCGHLLHKTCFDDMVQTGAYRCPLCMHSAWN
MEHNWEQMDKEITQSPMPTEYQDATVKIICNDCQTHCTVPFHVLGMKCSGCGSYNTAQNG
GLIRQSQEPQPQEPEQQPQSPVPEP
NT seq 798 nt   +upstreamnt  +downstreamnt
atggcttctctggttggatgcgaacactacgtgcgcagctgtttgttgaaagctccgtgt
tgtggtaaagcatatgtttgtcgcctgtgccatgacgctgaggaggaccatcaaatggac
cgcttcctggtcaaagaagtgcagtgctcagtctgcacaacagtacaacaggcacaacaa
aattgcgtggagtgtaatgtgacctttggggaatattactgtgatatctgtcacctgttt
gataaagacaagaagcagtatcactgtcagccctgtggaatttgcaggatcggaccaagg
gagaaatacttccactgtgagaagtgcaatctctgtttagccggagatctaagaggaaat
cacaagtgtgttgaaaatgtttcaagacagaactgcccagtgtgtatggaggatatccac
acatccagaataggagcccaaattcttccatgtggccatcttctacacaaaacatgcttt
gatgacatggtccaaactggtgcgtatcgatgcccactctgtatgcactctgcttggaat
atggagcacaactgggagcagatggacaaggagatcactcagtcacccatgcccactgaa
taccaggatgccactgtgaagatcatatgtaatgactgccaaacccactgtacggtgcct
ttccatgttctgggaatgaagtgcagtggctgtgggtcctacaacacagcacagaatggg
gggctgatacggcagtcccaggaaccacagccccaggagccagagcagcagccccagtct
ccagtgccagaaccatag

KEGG   Salmo salar (Atlantic salmon): 106585368
Entry
106585368         CDS       T04363                                 

Definition
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1-like
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106585368
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106585368
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sasa04121]
    106585368
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106585368
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    106585368
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-RING_UBOX Prok-RING_4 zf-RING_4 zf-RING_11
Other DBs
NCBI-GeneID: 106585368
NCBI-ProteinID: XP_014026961
UniProt: A0A1S3PH93
LinkDB
Position
ssa24
AA seq 304 aa
MAAPVGCDHYVRSCFLKAPCCGKAYVCRLCHDAEEDHQMDRFLVKEVQCSVCNTVQQAQK
TCQECNVTFGDYYCDICHLFDKDKKQYHCQPCGICRIGPREKYFHCQKCNLCLASDLRGN
HKCVENVSRQNCPVCMEDMHTSRIGAHVLPCGHLLHKTCFDDMVRTGAYRCPLCMHSAWN
MEDSWEQMDKDMAQSPMPTEYQDAIVKIICNDCQTHCTVPFHVLGMKCSGCGSYNTAQDG
GLIQQLQEPQQLQEPQQLQEPQQLQEPQQLQEPQQLQEPQPQEPQPQEPQPQEPQPQEPQ
SPEP
NT seq 915 nt   +upstreamnt  +downstreamnt
atggctgctcctgttggatgtgatcactacgtacgcagctgttttttgaaagctccatgt
tgtggtaaagcgtatgtttgtcgcctgtgtcatgatgctgaagaggaccatcaaatggac
cgcttcctggtcaaagaggtgcagtgctcagtctgcaacacagtacagcaggcacaaaaa
acctgccaggagtgtaatgttacatttggggactattactgtgatatctgtcacctgttt
gataaagacaagaagcagtatcactgtcagccctgtggaatatgcaggattggaccaagg
gagaaatacttccactgtcagaagtgcaatctctgtttagccagtgatctacgaggaaat
cacaagtgtgttgaaaatgtttcaagacagaactgcccagtgtgtatggaggatatgcac
acatcaagaataggagctcacgttcttccgtgtggccatcttctacacaaaacttgcttt
gatgacatggtccgaactggtgcgtatcgctgcccactctgtatgcactcggcctggaat
atggaggactcctgggagcagatggacaaagatatggctcagtcacccatgcccactgaa
taccaggatgccattgtaaagatcatatgtaatgactgccaaacccactgtacagtgcct
tttcatgttctgggaatgaagtgcagtggctgtgggtcttacaacacagcacaggatggg
ggactgatacagcaactccaggagccacagcaactccaggagccacagcaactccaggag
ccacagcaactccaggagccacagcaactccaggagccacagcaactccaggagccacag
ccccaagagccacagccccaagagccacagccccaagagccacagccccaagagccccag
tccccagaaccatag

KEGG   Salmo salar (Atlantic salmon): 106585722
Entry
106585722         CDS       T04363                                 

Definition
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1-like
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106585722
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106585722
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sasa04121]
    106585722
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106585722
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    106585722
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-RING_UBOX Prok-RING_4 zf-RING_4 zf-RING_11
Other DBs
NCBI-GeneID: 106585722
NCBI-ProteinID: XP_014027740
UniProt: A0A1S3PH93
LinkDB
Position
ssa24
AA seq 304 aa
MAAPVGCDHYVRSCFLKAPCCGKAYVCRLCHDAEEDHQMDRFLVKEVQCSVCNTVQQAQK
TCQECNVTFGDYYCDICHLFDKDKKQYHCQPCGICRIGPREKYFHCQKCNLCLASDLRGN
HKCVENVSRQNCPVCMEDMHTSRIGAHVLPCGHLLHKTCFDDMVRTGAYRCPLCMHSAWN
MEDSWEQMDKDMAQSPMPTEYQDAIVKIICNDCQTHCTVPFHVLGMKCSGCGSYNTAQDG
GLIQQLQEPQQLQEPQQLQEPQQLQEPQQLQEPQQLQEPQPQEPQPQEPQPQEPQPQEPQ
SPEP
NT seq 915 nt   +upstreamnt  +downstreamnt
atggctgctcctgttggatgtgatcactacgtacgcagctgttttttgaaagctccatgt
tgtggtaaagcgtatgtttgtcgcctgtgtcatgatgctgaagaggaccatcaaatggac
cgcttcctggtcaaagaggtgcagtgctcagtctgcaacacagtacagcaggcacaaaaa
acctgccaggagtgtaatgttacatttggggactattactgtgatatctgtcacctgttt
gataaagacaagaagcagtatcactgtcagccctgtggaatatgcaggattggaccaagg
gagaaatacttccactgtcagaagtgcaatctctgtttagccagtgatctacgaggaaat
cacaagtgtgttgaaaatgtttcaagacagaactgcccagtgtgtatggaggatatgcac
acatcaagaataggagctcacgttcttccgtgtggccatcttctacacaaaacttgcttt
gatgacatggtccgaactggtgcgtatcgctgcccactctgtatgcactcggcctggaat
atggaggactcctgggagcagatggacaaagatatggctcagtcacccatgcccactgaa
taccaggatgccattgtaaagatcatatgtaatgactgccaaacccactgtacagtgcct
tttcatgttctgggaatgaagtgcagtggctgtgggtcttacaacacagcacaggatggg
ggactgatacagcaactccaggagccacagcaactccaggagccacagcaactccaggag
ccacagcaactccaggagccacagcaactccaggagccacagcaactccaggagccacag
ccccaagagccacagccccaagagccacagccccaagagccacagccccaagagccccag
tccccagaaccatag

DBGET integrated database retrieval system