KEGG   Salmo salar (Atlantic salmon): 106580118
Entry
106580118         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase Chk2-like
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106580118
   04115 p53 signaling pathway
    106580118
   04218 Cellular senescence
    106580118
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106580118
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sasa03400]
    106580118
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106580118
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   106580118
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    106580118
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like Kdo RIO1 Pkinase_fungal APH YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 106580118
NCBI-ProteinID: XP_014016282
UniProt: A0A1S3NLI3
LinkDB
Position
ssa20
AA seq 508 aa
MSQEKPDAGSQTQTQSQPLTQSQTQSQSGSSSSSGSGTVSSVDTIPVRDLGSIPEEPEPQ
PWGRLLPMQRGFRAHNCVEDDTWFGRDSKCNYCFDDPILKESPRFATYSKKHFRIFREQN
IVYVFDNSGNGTFVDGILLGQGNTLPLANNAVLSLAEERHKVFVFIDLMADEQSNLPKEF
SEKYLITKKIGAGVCGEVKLAFERATCKKVAVKTINKKDFPASLGTATRNAEREIQILKK
IDHPCLIKTEDFFQTDDSYYIVLELMEGGELFDRVKSKNQIEESIAKLYFYQMLKAVEYL
HNNGIIHRDLKPENVLLSSQDDICVIKITDFNQSKILEESALMRTLCGTPTYLAPEVFTD
AVTVGYSSAVDAWSLGVVLFVCLAGYPPFHPNAQTGLSVRDQITQGIYTFIPSKWDGISD
DAKDVVKRLLLVDPNARLTIEEALHHPWLMDEAMKETAECIMYPRDSGDAAEADAAEADV
ASTTKRSREDDDDEQQPAKRPGPSTEAT
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtcccaggagaagccagatgctggcagccagacacagacacagtcgcagcctctgact
cagtcccagactcagtcccagagtggctccagctcctcctctgggtcaggcactgtcagc
tcagtggacaccatccctgttagggaccttggctccataccagaggagcctgagccacag
ccatggggtcgcctgctgcctatgcagagaggcttcagagcccacaactgtgttgaggac
gacacttggtttggccgggacagtaaatgtaactattgctttgatgaccccatactgaag
gaatcgcccagatttgcgacatacagcaaaaaacacttccgaatattccgagagcagaac
attgtctatgtctttgacaacagtggcaatggcacgtttgttgacggtatacttcttggg
caaggaaacactttgcctctagcaaacaatgcagtgctgtccctagctgaggaacgccat
aaagtgtttgtgttcattgatctcatggcggatgaacagtccaacctccccaaagagttc
agtgagaaatacctgattaccaaaaagattggagctggtgtgtgcggggaagtgaagctt
gcctttgagagggccacttgcaaaaaggtggctgtgaagacaatcaacaagaaggacttc
ccagcatctctcggcactgccacacgaaatgcggaacgagagatccagatcctcaaaaag
atagaccatccatgtctgatcaaaacagaagacttcttccaaacagacgactcctactac
attgttttagagctcatggagggtggagaactctttgacagggtcaaaagcaagaaccag
atagaggagtcaattgccaaactctatttttaccagatgttgaaagcagtagagtatctt
cacaacaatggcatcatccacagagacctcaaacctgaaaatgtgctgctttcgtctcag
gatgatatttgtgtcatcaagatcacagactttaatcagtccaagatactggaggagtct
gccctgatgaggaccctttgtggaacacccacataccttgcacctgaggtgttcaccgac
gcagtcaccgtgggctacagcagcgccgtagatgcttggagtttaggggtcgtcttgttt
gtgtgcttggcaggctatcccccattccaccctaatgcacaaactggtttgtcagtcagg
gatcagatcacgcagggaatatatacatttattccatccaaatgggacggcatctcggat
gacgctaaagacgtcgtgaagaggctgcttttagtggaccccaatgcccgcctcaccatt
gaggaggctttacaccatccctggctgatggatgaggccatgaaggagactgctgaatgc
atcatgtaccccagggactccggagatgccgcagaagctgatgccgcagaagctgatgta
gcttcaactacaaagaggtcaagagaagatgatgatgatgagcagcagccagcaaagaga
ccaggcccatccacagaggcaacatga

KEGG   Salmo salar (Atlantic salmon): 106585648
Entry
106585648         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase Chk2-like
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106585648
   04115 p53 signaling pathway
    106585648
   04218 Cellular senescence
    106585648
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106585648
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sasa03400]
    106585648
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106585648
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   106585648
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    106585648
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like Kdo RIO1 Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 106585648
NCBI-ProteinID: XP_014027547
UniProt: A0A1S3PIS4
LinkDB
Position
ssa24
AA seq 508 aa
MSQEKPDAYSQTQSQPQTQSQSGSSSSVPGSASQSSSGSGTVSSVDTIPVRDLGSIPEEP
EPQPWGLLLPMQRGFRAHNCVEDDAWFGRHTKCNYSFDVPILRESSRFAAYSNKHFRIFR
EKNIVYVFDNSNNGTFVDGNVIGKGKMLPLANNAVLSLAEERHKVFVFIDLMADEQSNLP
KELSEKYMITKKIGVGVCGEVKLAFERATCKKVALKTINKNDFPASVGTATRSAEREIQI
LQKIDHPCLIKTKDFFQTDDSYYIVLELMEGGELYDRVKSKQQIKEPIAKLYFYQMLKAV
EYLHNNGIIHRDLKPENVLLSSHDDVCVIKITDFNQSKILEESALMRTLCGTPTYLAPEV
FTDAVTVGYSRAVDAWSLGVVLFVCSLPLSLAGYPPFYPDARIGLSVSDQITQGIYTFIP
SKWDGISDDAKDVVKKLLRVDPNVRLTIEEALQHPWLMDEAMKETAEGIMYPKDSRDADG
TADSGDATVASTGKRSREDEEEQQPTKR
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtcccaagagaagccagacgcttacagccagacccagtcgcagcctcagacccagtcc
cagagtggctccagctcctctgttccaggctctgccagccagtcatcctctgggtctggc
acagtcagttcagtggacaccatccctgttagggacctgggctccataccagaggagcct
gagccacagccctggggcctcctgctgcctatgcagagaggcttcagagcccacaactgt
gttgaggacgacgcttggtttggtcggcacactaaatgcaactattcctttgatgtcccc
atactgagggaatcatccagatttgctgcatacagcaataaacattttaggatattccga
gagaagaacattgtctatgtctttgacaacagtaacaatggcacgtttgttgacggtaac
gttattggaaaaggaaaaatgttgccactagcaaacaatgcagtgttgtcccttgctgaa
gaacgccacaaagtgtttgtgttcattgatctcatggcggatgagcagtccaacctaccc
aaagagttaagcgagaaatacatgattaccaaaaagattggagttggtgtgtgcggggaa
gtgaagctggcttttgagagggccacttgcaaaaaggtggccttgaagactattaacaag
aatgatttcccggcatctgttggcactgccacacgaagtgcagaaagagagatccagatc
cttcaaaagattgaccatccatgtctgatcaaaacaaaagacttcttccaaacagatgac
tcatactacattgttctagagctcatggagggtggagaactctacgacagggtcaaaagc
aagcaacagatcaaggagccaattgccaagctatatttttaccagatgttgaaagcagta
gagtaccttcacaacaatggcatcatccacagagacctcaaacctgaaaatgtgctgctt
tcgtctcacgacgatgtttgcgtcatcaagatcacagactttaatcagtccaagatactg
gaggagtctgccctgatgaggaccctttgtggaacacccacatacctggcaccagaggtg
ttcacagacgcagtcactgtgggctacagcagggctgtagacgcctggagtttaggggtc
gtcctgtttgtgtgttctctccccctcagtttggcaggctatcccccattctaccctgat
gcacgaattggtttgtcagtcagtgatcagatcacccagggaatatatacatttattcca
tcaaaatgggacggcatctccgatgatgccaaagatgttgtaaagaaactgcttcgagtg
gaccccaatgtccgcctcaccattgaggaggctttacagcatccctggctgatggatgag
gcaatgaaggagaccgctgaaggcatcatgtaccccaaggactccagagatgccgatggc
acagcagactctggagatgccacagtagcctcaaccggaaagaggtcaagagaagatgag
gaagagcagcagccaaccaagaggtga

DBGET integrated database retrieval system