KEGG   Salmo salar (Atlantic salmon): 106580340
Entry
106580340         CDS       T04363                                 

Gene name
4EBP2
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 2-like
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa03013  RNA transport
sasa04012  ErbB signaling pathway
sasa04150  mTOR signaling pathway
sasa04218  Cellular senescence
sasa04910  Insulin signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    106580340 (4EBP2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106580340 (4EBP2)
   04150 mTOR signaling pathway
    106580340 (4EBP2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    106580340 (4EBP2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106580340 (4EBP2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106580340 (4EBP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sasa03019]
    106580340 (4EBP2)
Messenger RNA biogenesis [BR:sasa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     106580340 (4EBP2)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 106580340
NCBI-ProteinID: XP_014016725
UniProt: B5XGH2
LinkDB
Position
ssa20
AA seq 119 aa
MSSGCQKTTTSKSIPTRWVTINDATHMPHDYSTTPGGTPFIITPGGTRIIYDRQFLLECR
TSPLARTPPYSLPDIPGVTSPPSKHIINVKAHNGEPLNNNIAAPADKSTGDDAQFEMDI
NT seq 360 nt   +upstreamnt  +downstreamnt
atgtcttcgggctgtcagaaaaccactactagcaagtccattccgaccagatgggtgact
ataaacgacgcgacgcacatgccccacgactactccacaacccccggaggaactccgttc
atcataactcctggaggtacaagaattatctacgaccggcagttcctgctggagtgccgc
acttccccgctggccaggactcccccgtactctctccctgacattccaggggtcaccagc
ccaccctcaaaacacatcatcaatgtaaaggcccataacggagaaccactgaacaacaat
atcgcggcacctgctgacaagagcactggggatgatgcacagtttgaaatggacatctaa

KEGG   Salmo salar (Atlantic salmon): 106585258
Entry
106585258         CDS       T04363                                 

Gene name
4EBP2, eif4ebp2
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 2-like
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa03013  RNA transport
sasa04012  ErbB signaling pathway
sasa04150  mTOR signaling pathway
sasa04218  Cellular senescence
sasa04910  Insulin signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    106585258 (4EBP2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106585258 (4EBP2)
   04150 mTOR signaling pathway
    106585258 (4EBP2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    106585258 (4EBP2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106585258 (4EBP2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106585258 (4EBP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sasa03019]
    106585258 (4EBP2)
Messenger RNA biogenesis [BR:sasa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     106585258 (4EBP2)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 106585258
NCBI-ProteinID: XP_014026742
UniProt: B5DFY1
LinkDB
Position
ssa24
AA seq 119 aa
MSTGCQKTTTSKAIPTRRVTINDASHMPNDYSTTPGGTLFSTTPGGTRIIYDRKFLLECR
SSPLARTPPCSLPNIPGVTSPPSKHINNVKAHNREPLNNNITAPADKSTGDDAQFEMDI
NT seq 360 nt   +upstreamnt  +downstreamnt
atgtctacgggctgtcagaagaccactactagcaaggccattccgaccaggcgggtgacc
ataaacgacgcctcgcacatgcccaacgactactccactactcccgggggaactctgttc
agcacaacacctggaggtacaagaatcatctacgaccggaagttcctgctggagtgccgc
agttccccgctggccaggactccaccgtgctctctccccaacattccaggggtcaccagc
ccaccctccaaacacatcaacaatgtaaaggcccataacagagagccactgaacaacaac
atcactgcacctgctgacaaaagcactggggacgatgcacagtttgaaatggacatctaa

DBGET integrated database retrieval system