KEGG   Salmo salar (Atlantic salmon): 106580456Help
Entry
106580456         CDS       T04363                                 

Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9-like
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00512  Mucin type O-glycan biosynthesis
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    106580456
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sasa01003]
    106580456
Enzymes [BR:sasa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     106580456
Glycosyltransferases [BR:sasa01003]
 O-Glycan biosynthesis
  Mucin-type
   106580456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 106580456
NCBI-ProteinID: XP_014017018
UniProt: A0A1S3NNK4
LinkDB All DBs
Position
ssa20
AA seq 605 aa AA seqDB search
MAVARKIKTLLTVNIFVFVGIILFSVYCRIQDRSEELIQIGRISDQRLRARNGKVSNLVD
RQSILQRLERLEDVVYNQLNGLAKPMGLVEGPGGLGQGGAAATLGDDSHVDGEGKYEDYG
YNAQLSDRISLDRSIPDYRPKKCKQLTYPEDLPQISVVFIFVNEALSVILRSVHSVVNHT
PAHLLKEIILVDDNSDSVELKFNLDQYVNKRYPGLVKIVRNSKREGLIRARIHGWNAATA
PVVGFFDAHVEFNTAWAEPILTRVKEDHTRIILPAIDNIKFNTFEVQQYANAAHGYNWGL
WCMYIIPPQEWLDKGDETAPIRTPAMIGCSFVVDRKYFGEIGLLDPGMEVYGGENIELGM
RVWQCGGSMEVLPCARVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEYRSHVYMAWNI
PMNNPGVDYGDVSERVALRKRLQCRSFRWYLENVYPEMRIYNNTITYGEVRNSKASGYCL
DQGSEDDDKAILYPCHGMSSQLARYSTEGLLQLGPLGSTTFLPDTKCLIDDGRGRTPSLK
KCESVSRVSQRLWDFTQNGPIISRDTGRCMEVEMSKDANFGLRLVVQRCSGQKWMIRNWI
KHPKH
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcacgcaaaataaaaactttgctcacggttaacatttttgtttttgtgggg
atcatattgttctcggtatattgtagaatacaggaccgttctgaggaactcattcagatc
ggcaggatatcagaccagagactgagagccaggaatggcaaagtttccaacttggtggac
aggcagtccatacttcagagactggagcggctggaggacgttgtctacaaccaattaaat
ggtctggctaagcccatggggctggtggaggggcctggaggtctgggccagggaggagca
gctgctactctgggggacgacagccatgttgacggggaggggaagtacgaggactatggc
tacaacgcccagctcagtgaccgcatctccctggaccgcagcatccccgactacagaccc
aaaaagtgcaagcagttgacctatccagaggacctccctcagatctcagtggtgttcatc
tttgtgaatgaggccttgtcggtcatcttgcggtccgtccacagcgtggtcaaccacacc
cctgcacaccttctcaaggagatcatcctggtggacgacaacagtgacagtgtggagctg
aagttcaatctggaccagtatgtgaacaagcgttacccaggtctggtgaagatcgtccgc
aacagtaagagggaaggcctgatccgagccaggatacacggttggaatgctgcaaccgcc
ccggttgtaggtttctttgatgcccatgtagagttcaacactgcctgggcggagcctatt
ctgaccagggtgaaggaggaccacacccggatcatcctcccggccatcgacaacatcaag
ttcaacacattcgaggtgcagcaatacgctaacgcggcccatggctacaactggggcctg
tggtgcatgtacatcatcccccctcaggagtggctggacaagggcgatgagacagctccc
atcaggacgccagctatgatcggctgctcctttgtggtggacagaaaatactttggtgag
atcggcctccttgatcctggcatggaagtctatggaggcgagaacattgagcttggcatg
cgggtgtggcagtgtggggggagcatggaggtgctgccctgcgccagagtggcgcacatc
gagcggaccaagaagccatacaacaacgacattgactactatgccaagaggaatgccctg
cgggccgccgaggtctggatggatgagtacaggtcccacgtctacatggcctggaacatc
cccatgaataaccctggggttgactatggggacgtgtctgagcgggtggccttgaggaag
aggctgcagtgtcggagcttccgctggtacctggagaatgtctacccagagatgcgcatc
tacaacaacaccatcacatatggggaggtcagaaacagtaaggccagtggctactgtctg
gaccagggatcagaggacgatgacaaagccatcctctatccctgccacgggatgtcctca
cagcttgcccgttactcaacagaggggcttctacaactaggacccctagggtcgaccacc
tttctgcctgacaccaaatgtctcatcgacgacggaagagggcgcacgcccagcttgaaa
aaatgtgaatctgtttcacgggtttcccagaggctgtgggattttacacagaatggtcca
atcatcagcagggacactggacggtgcatggaggtggagatgtccaaagatgccaacttc
ggccttcgactggtggtgcagaggtgttctggtcaaaagtggatgatacggaactggata
aagcatccgaagcattga

DBGET integrated database retrieval system