KEGG   Salmo salar (Atlantic salmon): 106581525
Entry
106581525         CDS       T04363                                 

Definition
(RefSeq) protein phosphatase 1D-like
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106581525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106581525
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106581525
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    106581525
SSDB
Motif
Pfam: PP2C PP2C_2
Other DBs
NCBI-GeneID: 106581525
NCBI-ProteinID: XP_014019103
UniProt: A0A1S3NUM1
LinkDB
Position
ssa20
AA seq 577 aa
MEKALLMRVSVFSDQGGRKYMEDVTEVVMEPEPGEDELNSDEQDETKGNNSTADIVPEKP
ENEQEDRNALNNPLSASASTTVTWTQNVQNGNQHFAAAALAGSKVESTPAATKSDNRPQR
SVAFFAVFDGHGGREAAQFARDYLWEFIKKQRGFWSKDDEEVCAAIRKGFVACHHAMWKK
LPEWPKTFTGLPSTSGTTASVVVIRGDRMYVAHVGDSAIVLGVQDDPSDQFIRAVEVTQD
HKPELPKERERIEGLGGSVIKKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALG
DLWSYDFYSGEFVVSPEPDTCVLTLDPNKHRYVILGSDGLWNMVPPQDAVSMCQDNDEAM
APCGVSSARQLVSHALLRWRQRMLRADNTSAIVIALQEPGVPQEPLHHEEVLLNLAEGQH
CGPASYSRSNTPLIKVPDMDMPSAVCELLPTLERRNGLSGSSLYALALSDPFGPPLSDSD
DDSRSRFPLMTDSPAPGEKLSDVNARTPGSKRTLDETSPSPVPSTKRTRRKNGETTPVGA
AAGAKDGGGKDQKQTPPPTVSPALLQQQHGKTTVCVC
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggaaaaagcattgttgatgcgagtgagtgttttttccgatcagggaggcagaaaatac
atggaggatgttaccgaggtagtaatggagcccgagccgggggaagacgagctgaactcg
gacgaacaagatgaaaccaaagggaataactcgacggccgacattgtgccggaaaagcct
gaaaacgagcaggaagatcggaatgcactgaacaatcctctatctgcctctgcatccact
acagttacatggacacaaaatgtacaaaatgggaaccaacattttgcagctgctgcactg
gcaggatcgaaagtggagagtactccggcggcgaccaagagcgataaccggccccagcga
tcagtggctttcttcgcggtgtttgatggccacggaggccgagaggcagcgcaattcgca
agggactatttgtgggaattcatcaagaaacagcggggcttttggtccaaggatgacgag
gaagtgtgtgcagctattcggaaaggtttcgttgcctgccaccatgccatgtggaaaaaa
ctacccgaatggcccaagactttcacggggttacccagcacctcaggcaccacggccagt
gtagtggtaatccggggggaccgaatgtatgtggcccacgtaggagactctgccatagtg
ctgggggtgcaggatgacccctctgaccagttcatcagggctgtggaggttacacaggac
cacaagcctgagcttcccaaggagagggagcgtattgaagggctggggggcagtgtgata
aagaagtcgggtgtgaaccgggtggtgtggaagagacccaggctgactcataacgggcca
gtcaggaggagcacggtcatagaccagataccgttcctggctgtggccagagctctaggc
gacctgtggagctatgacttctacagcggagagtttgtagtgtccccggagccagacacc
tgtgttctgacccttgaccccaataaacaccgttacgtcatcctgggcagtgacgggctg
tggaacatggtgcccccccaggacgccgtctccatgtgccaggacaacgatgaggccatg
gcgccgtgcggggtgtccagcgctcgccagctggtgagccacgccctcctgcggtggcgc
cagaggatgctgcgcgcggacaacacgtcggccatcgtgatcgccctgcaggagccgggt
gtccctcaggagcccctccaccatgaggaggtactgctgaacctggctgagggacagcac
tgtggccccgcgtcgtactcccgctccaacacaccactcatcaaggttccagacatggac
atgccgtctgctgtgtgtgagctcctcccgaccctggagagacgaaacggcctatcaggg
agcagcctgtacgccttggccctatcagatcccttcggcccgcccctctctgactcggat
gacgactcccgctccaggtttcccttgatgacggacagccctgccccgggggagaagctt
agtgatgtcaatgccaggacacccggcagcaaacggacgctggatgagacgtcgcccagc
cccgtcccgtccaccaagaggacccggaggaagaatggcgagacaacaccggtgggagca
gcggcgggggcgaaagacggtggaggaaaagaccagaaacagactccgccccccaccgtg
tcccctgcactactccagcagcaacacggcaagaccaccgtgtgtgtgtgctga

KEGG   Salmo salar (Atlantic salmon): 106603268
Entry
106603268         CDS       T04363                                 

Definition
(RefSeq) protein phosphatase 1D-like
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106603268
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106603268
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106603268
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    106603268
SSDB
Motif
Pfam: PP2C PP2C_2
Other DBs
NCBI-GeneID: 106603268
NCBI-ProteinID: XP_014052161
UniProt: A0A1S3RIV1
LinkDB
Position
ssa04
AA seq 592 aa
MAMNDALIFRVSAFSEQGGRRYMEDVIEFKVEYEPPEPEPAEGGLNSVEQQGESKVEKQE
NGHTEQTIISNSPDNVQESVPVRAMWTENITSEKHEDISQAEVPAVHTVVRKSVAFFGVF
DGHGGREAAHFARDNLWGILKKQRGFWSEDQGEVCEAIRKGFIACHHDMWKELPEWPKTL
TGQPSTAGTTASIVLIRGNLMYVAHVGDSAVVVGVKEPGEKNIRALEVTQDHKPELLKEK
ERIERLGGSVVKKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDLWSYDFYS
GEFVVSPEPDVTVMTIDPKKHRYIILGSDGLWNMMPAKDAVAMCECHDQMVGPKGWSCAK
RLGCTALLFWRQRMLRADNTTVIVITVQHPDEPPMTMHLQELYVNMAEGLDKIPPVTTAN
SPRHYDCPIMQNPEVNTVSSVGEPLPLPALEWRNSLCEAGLCPSSEPLAEVDSQRVTPTD
RTLNVCAIEGTGTPGFSASSTPLVRRLRRPPHTPLSPSIAHHSLGRSPHSPLSPRMPRRS
LARSPRSPLSPRTSRRRLSDRTPLRRGGKGQRRSPNVPVILPQKRKAALCVC
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggccatgaacgacgcattaattttccgagttagtgcattctccgagcaaggaggaagg
agatacatggaggatgttattgagtttaaagtggagtacgaaccgcctgaaccagagcca
gcagagggtggtctgaattcggtagaacaacaaggggagtcaaaagtagagaaacaggag
aatgggcatactgagcagaccataataagcaattcccccgacaacgttcaagaatcggtg
cctgttcgtgcaatgtggacagaaaacataacaagtgagaagcatgaggacatttcccag
gcagaagttccagcagtgcacacggtcgttcggaagtctgtggcgttttttggtgtcttt
gacggtcacggagggcgagaagctgctcattttgctcgagacaatctgtggggtattctg
aaaaagcaaagggggttttggtcagaagatcaaggagaagtctgtgaagcaattcggaag
gggttcattgcctgccaccatgatatgtggaaagagctacctgagtggcccaagactctg
accggccagcccagtactgcaggaacaacggccagcatagtgctgatccgggggaatctg
atgtacgtagcccatgtaggggactcggcagtggttgttggggtgaaagagcccggtgaa
aagaacatcagggccttggaagtcacacaggaccacaaacctgaacttctcaaagagaag
gaacgcattgagagacttgggggcagtgtagtgaagaagtccggggtgaaccgtgtggtg
tggaagaggcccagactgacccacaatggccctgtcaggaggagcactgtcatagaccag
attccctttctcgctgtggccagagcgttgggggacctgtggagctatgacttctacagt
ggggagtttgtggtctctccagagcctgatgtcactgtaatgaccattgaccctaagaag
caccgctacatcatcctgggtagtgatggcttgtggaacatgatgccagctaaggatgct
gtcgctatgtgtgagtgccatgaccagatggtgggccctaagggatggtcctgtgccaaa
cggttaggatgcacggccttgctgttctggcgccagcgcatgctccgtgcagacaacaca
acggtcatagtgataaccgtgcagcaccctgatgagccacctatgaccatgcacctacag
gagctctatgtcaatatggcagagggccttgataagatcccccccgttacaaccgctaac
tctccccgccattacgactgccccattatgcagaacccagaggtaaacactgtgtcctct
gtgggtgagcctctccccctcccagctctggagtggaggaacagcctgtgtgaggctggt
ctctgtccctcttcagagcccctggcagaggtggactctcagagagtgactccaacagac
agaaccttgaacgtttgtgcaattgaaggcacagggactccagggttctcggcatcatcc
acccctctggtgaggaggcttcgtaggcccccacacactcccctctcccccagcatagca
caccacagccttggtcggtcccctcacagtcccttgtctcccaggatgcctcgccgcagc
ctggcccgttctccacgcagtcccttgtcccctagaacgtctcgccgcagactcagtgac
cgaacccctctgaggcgaggtggaaagggacagagacgctcccccaatgttcccgtcatc
ctaccacagaaacgcaaagctgccttgtgtgtgtgctga

KEGG   Salmo salar (Atlantic salmon): 106613321
Entry
106613321         CDS       T04363                                 

Definition
(RefSeq) protein phosphatase 1D-like
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106613321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106613321
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106613321
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    106613321
SSDB
Motif
Pfam: PP2C PP2C_2
Other DBs
NCBI-GeneID: 106613321
NCBI-ProteinID: XP_014070893
UniProt: A0A1S3T2S7
LinkDB
Position
ssa09
AA seq 301 aa
MENTLLMRVSVFSDQGGRKYMEDVTEVVVEPESGEDELNSNEHDDIKGDNSTVDIMPENE
QPDRTVHNEPLSASTTVAWTQNVQNGDLSCAAAALAVSTVESSPVQSDNRTQRSVAFFAV
FDGHGGREAAQFARDYLWEFIKKQRGFWSKDDEEVCAAIRKGFVACHHAMWKKLPEWPKT
LTGLPSTSGTTASVVVIRGDRMYVAHVGDSAIVLGVQDDPSDQFIRAVEVTQDHKPELPK
ERERIEGLGGSVIKKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDLWSYDF
Y
NT seq 903 nt   +upstreamnt  +downstreamnt
atggaaaacactttgttgatgcgagtgagtgttttctccgaccagggaggtaggaaatac
atggaggacgttaccgaggttgtagtggagcccgagtccggggaagacgagctgaactcg
aacgaacatgatgatatcaaaggggataactcgacggtggacattatgcctgaaaacgag
cagcctgatcggactgtacacaacgagcctctatctgcctccactacagttgcatggaca
caaaatgtacaaaatggggacctaagttgtgctgcagctgcactggcagtttccacagtg
gagagttcaccggtccagagcgataaccggacccagcgatcagtggctttcttcgcggtg
tttgatggccacggaggccgagaggcagcgcagttcgcacgggactatttatgggaattt
atcaagaaacagcgggggttttggtccaaggatgacgaggaagtgtgtgcagctattcgt
aaaggtttcgttgcctgccaccatgccatgtggaaaaagctgcccgaatggcccaaaaca
ctcacagggcttcccagcacctcgggcaccacggccagtgtagtggtaatccggggggac
cgaatgtacgtggcccacgtaggagactctgccatagtgctgggggtccaggatgacccc
tctgaccagttcatcagggccgtggaggttacacaggaccacaagcctgagcttcccaag
gagagggagcgtattgaagggttggggggcagtgtgataaagaagtcgggtgtgaaccgg
gtggtgtggaagagacccaggctgactcataacgggccagtcaggaggagcacggtcata
gaccagataccgttcctggctgtggccagagctctaggcgacctgtggagctatgacttc
tac

DBGET integrated database retrieval system