KEGG   Salmo salar (Atlantic salmon): 106581867Help
Entry
106581867         CDS       T04363                                 

Gene name
hdac4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106581867 (hdac4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106581867 (hdac4)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106581867 (hdac4)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     106581867 (hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 106581867
NCBI-ProteinID: XP_014019767
UniProt: A0A1S3NWJ6
LinkDB All DBs
Position
ssa21
AA seq 1097 aa AA seqDB search
MKGHPPAVHVFADGAPPPLYSSPGASLTDGLDGSCSVPRVGIGARSCCQGKRAVAGSQLP
QFWRTATHTHTLFDVRAALPMQVPPAAIPMDLRMDQPFGLAPRPDDQGHQGQVPGQREQQ
LQQELLALKHKQQIQRQLLIAEFQRQHEQLSRQHEVQLQEHVKHQQDLLALKHQQELLEH
QRKMERHRQEQEMEKQQREQKLLLLKNKERGQESAVASTEVKMRLQEFVLNKKKALAQRS
LNHCMNTDPRYWYGKTQHSSLDQSSPPQTGMSPYSHAILGMYDPKDDFPLRKTASEPNLK
LRSRLKQKVTERRSSPLLRRKDGPIITTAKKRSLDMAESACNSAPGSGPSSPNNSSSNIT
NENGIASPVEASLAHRLAGREGPLSQLSLYTSPSLPNITLGLPATGPSSMTSGQQDGDRL
SMHERLPQGISITTPFIPGAHLPSYLTDGGSAHNPLLQHMVLLEQSQNPLGLSCCLGGLP
LQSPSIHKLRGQHRPLGRTQSAPLPQNAQALQQLVVQQQHQQFLEKHKQQFQQQQLHINK
MMAKPSEPGPGRQHESHPEETEEELREHQALCPQEGVLMHGVTVKQEPPDPQEEEMDNQE
RTVDQELLFRQQAVLLEQQRMIQLRNYQASMESAGLSVTFPVHRPLSRAQSSPASACFPP
IAVQQEPPTKPRFTTGLVYDTLMQKHQCMCGNTNTHPEHAGRIQSIWSRLQETGLRGKCE
CIRGRKATLEELQTVHSEAHVLLYGTNPLRQKLDSSLTPMFVRLPCGGVGVDSDTIWNEV
HSSSAARLAVGSVVELVFKVAAGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLL
QQRLSVSKILIVDWDVHHGNGTQQAFYSDPNILYLSLHRYDDGNFFPGSGAPDEVGTGAG
MGFNVNMAFTGGLEPPMGDAEYLAAFRTVVMPIANEFAPDVVLVSSGFDAVDGHASPLGG
YKLTAKCFGYLTRQLMGLAGGRLVLALEGGHDLTAICDASEACVSALLGIELDPIPEEVM
QQRPNPNAVHSMEKVLEEHGKYWRSLQRGASTLGYSLSESRQCETEEAETVTAMASLSVA
NKQRRSEEEPMEEEAPL
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggccacccgcctgctgtacatgtgtttgcagatggggcacccccccccctctac
tcgagccctggtgccagcctcacagatggccttgacggctcctgctctgtcccccgcgtt
ggcatcggtgcccggtcgtgctgccagggcaagcgggcggtagcagggagccagctgcct
cagttctggagaaccgcaacacacacacacacgctgttcgacgtgagagcggcactgccc
atgcaggtgcccccggccgccatccccatggacctgcgcatggaccagccctttggcctg
gcaccgcgaccagacgaccagggccaccaaggacaggtcccaggtcagcgggagcagcag
ctgcagcaggagctgttggccctcaaacacaaacagcagatccagagacagctgctcatt
gccgagttccagcggcaacatgagcagctctcacgccagcatgaggtccagctacaggag
catgttaagcaccagcaggacctcctggccctgaagcatcagcaggagctgctggagcac
cagaggaaaatggagagacaccgccaagagcaggagatggagaagcagcagagggagcag
aaactcctactgctcaagaacaaggagcgtggccaggagagcgcggtggccagcacggag
gtcaagatgcggctgcaggagtttgtcctgaacaagaagaaagccctggctcagcgcagc
ctcaaccactgcatgaacactgacccacgctactggtatgggaagacccagcatagctcc
ctggatcagagctcccctccccagacagggatgtccccttacagccacgccatcctgggg
atgtacgaccccaaagacgactttcctctacgcaagacagcctctgagcccaacttgaag
ctccggtccaggcttaaacagaaggtgacagagcgcagaagtagcccactgctacgtagg
aaggatggtccaataatcactactgccaagaagcgctctctggacatggctgaatcggcc
tgcaacagcgcacctggctcgggccccagttcgcccaacaacagctccagtaacatcacc
aatgagaacggcatcgctagtccagtagaggcctccctggcccacaggctggccggccga
gagggccccttgagccagctgtctctgtacacatcgccctcactgcctaacatcaccctg
ggcctgccagccaccggcccgtccagcatgacgtcaggccagcaggatggtgacaggcta
tcgatgcatgagaggctgccgcagggcatctccataaccactcccttcatcccgggggcc
cacctgccctcctacctgactgatgggggctcggcacacaaccccctcctccagcacatg
gtcctcctggagcagtcccagaacccactaggtctgtcctgctgcctgggcgggctgccc
ttgcagtcgccctccatccacaagctgcgtgggcagcaccgtcccctggggaggacccag
tcggcccctctgccccagaacgcccaggccctgcagcagctggtggtccagcagcagcac
cagcagttcctggagaaacacaagcagcagttccagcagcagcaactgcacatcaacaag
atgatggccaagcccagcgagccagggccgggtcgacagcacgagagccacccagaggag
acagaagaggagctaagggagcaccaagccctgtgtccccaggaaggagtcctcatgcac
ggggtgacggtcaagcaggagcccccggaccctcaggaagaggagatggacaaccaagag
aggacggtcgaccaggagctgctcttcagacagcaggctgtgttattggagcagcagagg
atgatccagttaaggaactaccaggcttccatggagtcagccggcctgtcagtcactttc
ccagtgcaccgccccctctccagggcccaatcatctcccgcctcggcctgcttccccccc
attgcggtacagcaggaaccgcccaccaagcctcgcttcaccactggcctggtgtatgac
acgttgatgcagaagcaccagtgtatgtgtggcaacaccaacacacacccggagcacgcc
ggacgcatccagagcatctggtcccgactgcaggagactggactgaggggcaagtgtgag
tgtatccgagggcggaaagccactctggaggagttgcagacggttcactctgaggctcac
gtccttctgtatggaaccaacccactccgacagaaactagacagttcattgactcccatg
ttcgtgaggctgccttgtggaggggtaggggtggacagcgacaccatttggaacgaggtc
cactcgtccagcgcggctcgtctggctgtgggctccgttgtggagctggtgttcaaagtg
gcggctggagagctcaagaacggctttgctgtagtccggccccctggacaccacgcagag
gagagcacacctatgggattctgttacttcaactccgtggccatcgcagctaaacttctg
cagcagaggctcagtgtcagtaagatcctgattgtggattgggatgttcatcatggaaat
ggcacgcaacaagcattctacagcgaccccaacattctctatctgtcactccatcgctac
gacgatggcaacttcttccccggcagtggagcgcctgatgaggtgggcactggggcaggc
atgggcttcaatgtgaacatggctttcaccggggggctagaaccacccatgggagacgca
gagtacctggctgccttcaggacggtggtgatgcctatcgccaacgagtttgctcctgac
gtggtcctggtgtcttcaggattcgatgctgtggacggccacgcatcacccctgggaggg
tacaagctaacagccaaatgtttcggctacctgaccaggcagctgatggggctggccggg
ggacgcctggtactggccctggaggggggccatgacctcactgccatctgcgatgcctct
gaagcctgtgtctctgctttgctaggaatcgagttggatcctatccctgaggaggtgatg
cagcagaggcccaaccccaacgccgtccactccatggagaaggtgctggaggaacacggt
aaatactggcgctctctgcagcgcggggcctccacactgggctactctctgagcgagtct
cgtcagtgtgagacggaggaagctgagaccgtcactgccatggcttccctctctgtggcc
aacaagcagaggaggagcgaggaggagcctatggaggaggaggcgcctctgtaa

DBGET integrated database retrieval system