KEGG   Salmo salar (Atlantic salmon): 106581955
Entry
106581955         CDS       T04363                                 

Gene name
gpr161
Definition
(RefSeq) G protein-coupled receptor 161
  KO
K08439  G protein-coupled receptor 161
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106581955 (gpr161)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sasa04030]
    106581955 (gpr161)
G protein-coupled receptors [BR:sasa04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    106581955 (gpr161)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srsx Dpy19
Other DBs
NCBI-GeneID: 106581955
NCBI-ProteinID: XP_014020003
UniProt: A0A1S3NXM6
LinkDB
Position
ssa21
AA seq 533 aa
MNASGNVSTVGNATAAWDAGGGPVVLESVFIVTIALLACLGNFLIVATLYRRPYLLTPSN
KFVFSLTLSNLLLSVLVLPFVAVSSARREWVFGVVWCNFTALIYLLISSASMLTLGAIAI
DRYYAVLYPMIYPMKITGNRAVVAIAYVWLHSLVGCLPPLFGWSSFEFDRFKWTCVAAWH
RTPAYTAFWVTWCSLPPLLAMLACYGVIFRVARLKARKVHCGTTVASSEETSSGAQRNDQ
RKNSSTSTSSNGSRWSLVYAGSQCKAFVTIMVVIGTFLVTWGPYVGVVCTEALWGQGSVS
QGLETLVAWLSFCSAVCHPLIYGLWNKTVRKELLGMCFGDRYYRVESFATRHRTSRLFSI
SNRITDLGMSPHLTAMLVGGGQLLAPGSSTGDTGFSFTQDSCTDVMLLDTFSTDGSSHIG
SVAVKRRSSVTFEDEQQQNSKAAESTTIPSTVQVQVEIHKSLDTFASCLARAIESDAKLT
LFGEDTPLSGVLFAAAARGAQRPRYLDGQRLRLESIDEGIVKDDREDQERENA
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgaatgctagcgggaatgtctccactgtgggaaacgccacagctgcgtgggacgctggc
gggggcccggtggtgctggagtcagtgttcatcgtcaccatcgccctcctggcctgcctg
ggcaacttcctcatcgtggccaccctgtaccgcaggccctacctcctcacacccagcaac
aagtttgtgttcagcctgaccctgtccaacctgctgctgtcagtgctggtgttgcccttt
gtggcagtgagctcagcgcggcgggagtgggtgtttggtgtggtgtggtgcaactttacc
gccctgatctacctgctcatcagctcggccagtatgctcaccctgggggccatcgccatt
gacaggtactatgcggtactgtaccccatgatctaccccatgaagatcacaggcaaccgg
gcggtggtggcaatcgcctatgtgtggctgcactccctggtgggctgcctgccacccctc
ttcggctggtcctccttcgagttcgaccgcttcaagtggacatgcgtggcggcctggcac
cgcacccctgcctacaccgccttctgggtcacctggtgcagcctgccgccgctgctcgcc
atgttggcctgctacggcgtaatcttccgcgtggcacgcctcaaagcccgcaaggtgcat
tgtgggacgacggtcgcgtcttcagaggaaacgtcatcgggtgctcagaggaacgaccag
cgtaaaaactcatctacgtccacgtcgtccaacggaagccggtggagtttagtgtatgct
gggagccagtgcaaggctttcgtcaccattatggtggtgatcgggaccttcctggtgacc
tggggcccctacgtgggggtggtgtgtacagaggccctgtggggtcagggcagcgtgtcc
cagggcctggagaccctggtggcctggctgtccttctgcagcgccgtctgccacccgctc
atctacggcctgtggaacaagactgtgcgcaaggaactgctgggcatgtgcttcggggat
cgctactaccgcgtggagtcgttcgccacacgccaccgcacgtcacgcctcttcagcatc
tccaaccgcatcacagacctgggcatgtcccctcacctgacggccatgttggtgggagga
gggcagcttctggcccccggcagcagcactggagacactggcttcagtttcactcaggac
tcatgtacagacgtcatgctgcttgacaccttctccacagatggctcttcccacattgga
agcgtggccgtaaagaggcggagctcggtcacctttgaagacgaacaacagcagaattcc
aaagctgcagagagcaccaccattccctctactgtccaggtccaagtagagatacacaaa
tctctggacaccttcgcctcctgcctggccagggccatcgaaagcgacgctaagctcacc
ctctttggcgaggacacacccctatctggggtgttgtttgcggctgcggcgaggggggca
cagaggccccgttaccttgacggtcagagactgaggctggagagcatcgatgaagggatc
gtcaaagacgacagagaagaccaagagagggagaatgcatag

DBGET integrated database retrieval system