KEGG   Salmo salar (Atlantic salmon): 106582799
Entry
106582799         CDS       T04363                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
sasa  Salmo salar (Atlantic salmon)
SSDB
Motif
Pfam: RA Nore1-SARAH Ras_bdg_2
Other DBs
NCBI-GeneID: 106582799
NCBI-ProteinID: XP_014021710
UniProt: A0A1S3P2E9
LinkDB
Position
ssa22
AA seq 277 aa
MTDGSDKSLSFEKTWGSSTSSGYCSGDSDSEFEQYFTARTSFLHKPKKEKDEQVEWGKQQ
VDLSVTEIQQKVKEYNAQINSNLFMNLNKDGSYTGFIKVQFKLLRPVSVPPPRKGTATHD
GACKKTGGVKRRTSFYLPKDTSKHLHISSRTCAREVIEALLKKFTVVDNPGKFALFERTK
RHDQVFLRKLSDDERPLHLRLCAGPNDKALSLVLKENETGEVNWDAFSMPELKNFVRMLQ
REEEEHVKQIVQRYALARTRMQEAQAASPTPGGSTPG
NT seq 834 nt   +upstreamnt  +downstreamnt
atgacagacggttcggataaaagcctgtccttcgagaagacgtggggcagctccaccagc
agcggatactgcagtggggactccgattcagagttcgagcagtacttcactgctcgcaca
tcattccttcacaaacccaagaaggagaaggatgaacaggttgaatgggggaagcagcag
gtggatctgtcagtcacagagatccagcagaaggtgaaggagtacaatgctcaaatcaac
agcaacttgttcatgaacctgaacaaagatggctcctacactggcttcataaaggtccag
ttcaagctgctacgacccgtgtcagttcccccaccaagaaagggtactgcaacacatgat
ggtgcatgcaagaagactgggggagttaagcgtcgcacctctttttacctgcccaaggat
acgtccaaacacctacatatcagctcccgcacatgtgctcgtgaggtcatcgaagccttg
ttgaagaagttcaccgtggtggacaaccctggaaagtttgctttgtttgagcgcacaaag
cgccatgaccaagtattcctgcgtaagctgtctgacgacgagcgtccactccacctgcgt
ctgtgtgctggacccaatgacaaagccctcagtttggtgttaaaagagaatgagactgga
gaggtcaactgggatgccttctctatgccagagctcaagaactttgtccgcatgttacag
cgtgaggaggaggagcatgtcaagcagatagtgcagcgctacgcactagcccgcaccagg
atgcaggaggcccaagctgctagtcccacccctggtggttccacccctggctga

DBGET integrated database retrieval system