KEGG   Salmo salar (Atlantic salmon): 106583085
Entry
106583085         CDS       T04363                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106583085
   04068 FoxO signaling pathway
    106583085
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106583085
   04115 p53 signaling pathway
    106583085
   04218 Cellular senescence
    106583085
SSDB
Motif
Pfam: CDI PMSI1 DUF2576
Other DBs
NCBI-GeneID: 106583085
NCBI-ProteinID: XP_014022361
UniProt: A0A1S3P471
LinkDB
Position
ssa22
AA seq 157 aa
MCRTRTTMASRKRILSALGKGPARRNLFGPVDHEQLQQEYQNALRRDLEDACHRWGFDFL
SEKPLAGGDFQWEGVLGTKLPLLYQPCLLGQGEAQREGGLAAITGRGGAGPLHRVKENIP
CTPEKCGANHQNLEKTPDKKENTNHNENRLKMKQTED
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtgtagaaccagaacaaccatggccagtcgtaagcggattctgagcgccctggggaaa
ggtcctgccagacggaacctgttcggcccagtggaccatgagcagctgcagcaggagtac
cagaatgccttgcgcagagacctggaggacgcctgccaccgctggggctttgatttcctg
tcagagaagcctctggctgggggagacttccagtgggagggggttctaggcaccaagctg
ccgctcctctaccaaccctgccttttgggtcagggagaggcacagagggagggaggcctg
gcggccatcacagggaggggcggggcagggccattgcaccgtgtcaaggagaatatccct
tgcacccctgagaagtgcggagccaaccaccagaacctggagaaaacaccagacaagaag
gagaacacgaaccacaatgaaaacagactgaagatgaaacagaccgaagactaa

DBGET integrated database retrieval system