KEGG   Salmo salar (Atlantic salmon): 106583101Help
Entry
106583101         CDS       T04363                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00020  Citrate cycle (TCA cycle)
sasa00190  Oxidative phosphorylation
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
Module
sasa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sasa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sasa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106583101
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106583101
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106583101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 106583101
NCBI-ProteinID: XP_014022392
UniProt: A0A1S3P469
LinkDB All DBs
Position
ssa22
AA seq 283 aa AA seqDB search
MSVVCLSSLGRCSTVAFRSSSGMVAVRYAQTAAATAPQPRVKKFQVYRWDPDTVGDKPRM
QTFEIDLNTCGPMVLDALIKIKNEMDGTLTFRRSCREGICGSCAMNINGGNTLACLNKID
TNTRKATKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDETNEGKEQYHQTVEDRQ
KLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLSKLQDPF
SLYRCHTIMNCTKTCPKGLNPGKAIAEIKKMMATYKEKKSAVA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcgtttgtctatcgtctttgggtcgttgtagcaccgtggcattccgttcttcc
agtggaatggtggcggttcggtacgcccagacagcggcggccacagcaccccagcccaga
gtcaagaagttccaggtgtaccgctgggacccagacacggtgggggacaagccccgcatg
cagacctttgagattgatctcaacacctgtggacccatggtattggacgccctcatcaag
ataaagaatgagatggacggcactctgaccttccgtcgctcctgcagagagggtatctgt
ggatcctgtgcaatgaacatcaatggaggcaacacactggcctgtctgaacaagattgac
accaacaccagaaaggctaccaagatctaccctctgccacacatgtatgtggtcaaagat
ctggtccctgacatgagtaatttctatgctcagtacaagtcaattgagccctacctgaag
aagaaggatgagacaaatgagggaaaggaacagtaccatcagactgtggaggacagacaa
aaactggacgggctgtatgaatgtatcctgtgtgcgtgctgcagcaccagctgccccagc
tactggtggaatggagacaagtacctgggacctgctgtcctaatgcaggcctaccgttgg
atgatcgactcgagagatgagttcacagaggagcgtctctccaagctgcaggatcctttc
tctctctaccgctgtcacaccatcatgaactgcactaagacctgccccaagggcctgaac
ccagggaaggcgattgcagagattaagaagatgatggccacttacaaggagaagaaatca
gctgttgcttga

DBGET integrated database retrieval system