KEGG   Salmo salar (Atlantic salmon): 106583136
Entry
106583136         CDS       T04363                                 

Gene name
mdm4
Definition
(RefSeq) MDM4, p53 regulator
  KO
K10127  protein Mdm4
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106583136 (mdm4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sasa04121]
    106583136 (mdm4)
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    106583136 (mdm4)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP DZR Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 106583136
NCBI-ProteinID: XP_014022445
UniProt: A0A1S3P4F5
LinkDB
Position
ssa22
AA seq 497 aa
MTSLPSPQQYTASSSACNILPGDGSQVQPKAPLLQILRVAGAQEDIFTLKEVMHYLGQYI
MGKQLYDKQRQHIVHCQDDPLGELLEVESFSVKNPSPVYEMLKKYLVVLNCSDAAESLSV
GRECVEGGVEDRGQVCGGVAKAGLVVASDEALPMQTPSQRRPREPDEDSLDGLPQSACKR
PKLDVTLDEWDLSGLPWWFLGNLRNNYSRRSNGSTDIHTNQLSPAQDEDTAIVSDTTDDL
WFLTEGGSEQVSVEMKEAVLEEGSGGEGEPPPEEEGGGKEEKADKEMQEEPDEDSQCLSD
DTDIEISTQDAWQCTECRKYNSPLQRYCVRCWALRKNWYKDVPRLVHSLSVPDIPACSSL
APRDDEEESDTGIDVPDCLRTVSDPVILPSHSTPDRLLPPGVPGKGKGPRPRALPREEQL
SGGESQESLGMEVEVRPEALLEPCKLCRMRPRNGSIIHGRTAHLLTCFSCARKLHKFHAP
CPGCGQIIQKVIKTFIA
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacctcgttaccgtcaccccagcagtacacagcatcaagctcagcatgcaacatatta
cctggtgatgggagtcaggtgcagcccaaagcccctctcctgcagattctgcgtgtggct
ggagcccaggaggacatctttaccctcaaggaggtgatgcactacctgggccagtacatc
atggggaagcagttgtatgataaacagaggcagcacatagtgcactgtcaggacgaccca
ctgggagagctgctggaggtcgagagcttctccgtcaaaaaccccagtccagtctacgag
atgctgaagaagtatttagttgtgctgaattgttcagacgctgcagagagtctttctgtg
ggccgtgagtgtgtagagggcggagtggaggaccgcggtcaggtgtgtgggggcgtggcc
aaggcgggcctggttgtggccagtgacgaggccctccccatgcagactccgtctcagaga
cgaccccgggagcctgacgaagactctttagatggcttgccccagtcggcctgcaaacgc
cccaagctcgatgtcacactagacgagtgggacctctcagggcttccctggtggtttctg
ggtaatctgcgtaacaactacagtcgcagaagcaacggctctacggacatccacactaat
caactgtctcctgcgcaggatgaggacacagcgatcgtgtcggacacgacggacgacctg
tggttcctgacggaggggggaagtgaacaggtgagcgtggaaatgaaggaggccgtgctg
gaagaagggagtggaggagaaggagagccaccacctgaagaggagggaggaggaaaagag
gagaaggctgataaggagatgcaggaggagccagatgaggactctcagtgtctgagtgat
gatacggatatagagatctctacacaggatgcatggcagtgtacagagtgcaggaagtac
aactctcctctccagcgctactgcgtacgctgctgggctctacgcaagaactggtacaaa
gacgtcccacggttggtccactcactttccgtccccgacatcccagcatgcagttctctg
gccccgcgagacgatgaggaggaaagcgacacaggcattgacgtcccagactgcctcagg
accgtgtctgaccccgtcatcctgccctcccactccacccccgaccgcctgctgcccccc
ggggttccagggaagggaaagggtcctaggccgcgagcccttcccagggaggagcagctc
tctgggggagagagtcaggaaagcctggggatggaagtagaggttaggcccgaggcgctg
ttggagccttgtaagctgtgtcggatgcgtccgcgtaatgggagtattatacacggccgc
acggctcacctgctaacctgcttctcctgcgccaggaagctgcacaagttccacgctcca
tgtcccggctgtggacagatcatacagaaggttataaagacattcatagcttga

DBGET integrated database retrieval system