KEGG   Salmo salar (Atlantic salmon): 106583550
Entry
106583550         CDS       T04363                                 

Definition
(RefSeq) protransforming growth factor alpha-like
  KO
K08774  transforming growth factor, alpha
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106583550
   04012 ErbB signaling pathway
    106583550
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 106583550
NCBI-ProteinID: XP_014023334
UniProt: A0A1S3P711
LinkDB
Position
ssa22
AA seq 198 aa
MMNRAFWDAIFLITGSLFTYGIGQDNSTIATNSTMTTTPPVTTTVNVTTSSTTTTSITTT
TTIPVKKFVAAAVRSHFDDCPDSHSHFCFHGTCRFLILEETPACVCHQGFVGMRCEHADL
LAVVATNHRQQTVATVLVLCVIGCVLTMLLCTLLHCWWRRDGLGRRHRLHCAPEKQGSML
KGRGSCCHSESVACYGSI
NT seq 597 nt   +upstreamnt  +downstreamnt
atgatgaatcgggctttctgggatgcgatatttctcattactggttccctctttacatat
ggaataggccaggataattccactattgctactaattctacaatgaccaccacacctcct
gtaactaccactgtaaatgttactacctcttctactaccaccaccagtatcaccactaca
accaccattccagtgaaaaagtttgttgcagcagctgttcgatcccacttcgatgactgt
cctgactcccacagccacttctgtttccatggcacctgtcgtttcttgattctggaggag
acgcctgcatgtgtgtgtcaccaaggcttcgtagggatgcgatgtgagcacgccgacctg
ctagctgtcgtggccaccaatcacaggcaacagacagttgccacggtgctagttctgtgt
gtgattggttgcgtcttgacgatgctgctctgcacccttttacattgctggtggaggcgg
gacggtttggggcggaggcacagactccactgtgccccagagaaacaaggcagtatgctg
aagggccgagggtcctgctgtcactctgaaagtgtggcatgctatgggtctatctga

DBGET integrated database retrieval system