KEGG   Salmo salar (Atlantic salmon): 106583799
Entry
106583799         CDS       T04363                                 

Definition
(RefSeq) protein shisa-5-like
  KO
K10135  scotin
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106583799
SSDB
Motif
Pfam: Shisa Orthoreo_P10 Endomucin
Other DBs
NCBI-GeneID: 106583799
NCBI-ProteinID: XP_014023851
UniProt: A0A1S3P8C1
LinkDB
Position
ssa22
AA seq 283 aa
MAENLCVVMLLLCGTIIPFVTADDCEGYVDAKSQYHYKQYCGAYVGCCGTCDNRYCCSNV
YGQRKLEQDSCYLSSSSSSSSSSTFTIWPFIAIPVTFVIIFISCCVCPCCCLYNMCRKPR
PVIATTSHTTVVNTQFTQQPQQPVQIYQGGPQYPAYQPVPVQPGYGAQPQPGYGGGQPMP
TAPGNQGQPFQPGPPPPYQESGPAYPPAIPVPYSQAGFSPGQPSYPFQPPAQPSYPAQHP
GYPAQQPAYPAQAGAPPVQPDFLSAQPAYNPAFVDSQPPKTCY
NT seq 852 nt   +upstreamnt  +downstreamnt
atggcggagaatctgtgcgttgttatgctcctcttatgtgggactataatccccttcgtg
accgctgatgactgtgagggctacgtagatgccaagagccaataccattacaagcagtac
tgcggtgcatatgtggggtgctgtggaacgtgtgacaatagatactgctgcagcaatgtc
tacggacagaggaagttggaacaggacagctgttatttaagtagcagtagcagcagcagt
agcagtagcacgttcaccatctggccgttcatagcaatacctgtcaccttcgtgatcatt
ttcatctcttgctgcgtgtgtccctgctgctgcttgtacaacatgtgcaggaagcccaga
ccggtgatagccacgacctctcacaccacagtggtgaacacccagttcacccagcaaccc
cagcagcccgtccagatctaccagggtggcccccagtacccagcctaccagcccgtaccc
gtccagcctgggtatggggctcagcctcaacccggctacggaggagggcagcccatgccc
acagcaccgggtaaccagggacagcccttccagccaggaccaccccctccctaccaagag
tctggtccagcctatccgcctgctatcccagtgccttatagtcaggctgggttcagtcca
ggacagccatcataccccttccagcctccagctcagcccagctacccagcccagcatccc
ggctacccagcccagcaaccagcctacccggcccaggctggcgcgcctcccgtccagcct
gacttcctctctgctcagcctgcctacaaccctgccttcgtggactcccaacctccgaag
acttgctactga

DBGET integrated database retrieval system