KEGG   Salmo salar (Atlantic salmon): 106584117
Entry
106584117         CDS       T04363                                 

Gene name
pdgfra
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04020  Calcium signaling pathway
sasa04144  Endocytosis
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106584117 (pdgfra)
   04020 Calcium signaling pathway
    106584117 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106584117 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106584117 (pdgfra)
   04540 Gap junction
    106584117 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106584117 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106584117 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:sasa04090]
    106584117 (pdgfra)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106584117 (pdgfra)
Protein kinases [BR:sasa01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   106584117 (pdgfra)
CD molecules [BR:sasa04090]
 Proteins
  106584117 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Receptor_2B4 Kinase-like
Other DBs
NCBI-GeneID: 106584117
NCBI-ProteinID: XP_014024468
UniProt: A0A1S3PA42
LinkDB
Position
ssa23
AA seq 1464 aa
MDEMKTCLIIGVVLFGLLSVTCGLTPPTIVSTEDEFVLEPLSVFNISCTSERNVAWVEPL
PNNTFVLPGYYTATLFIYNASVTHTGYYTCKYQDKEGDEEDDEENEAVIYVFVPDPKVPF
VPEEPGSMVVLVYPGETIIPCRVSDPHYPVVLKSAPSGVEVDAAYDNKIGFIGNLDAGLY
VCETTVNGVTMTSDIYTVEDNKLMEDFHVEVKASEEAVRLGQPFNITCVAPPGLPYQQQW
LHPRKQAVDAVQMKQTLPDRVVYTLSIPAASSQDSGVYECSITNNFNGEIRANMVAVTVF
EENSFVMLDHSGIGAVEFVGMMEETEFTISIEAFPAPKVTWLKDGIAITENSYFLTKTRR
LVGDHYQSTLTLRQSLEKDSGNYTIVVLSSAHIAQFSFTLKVKESGPVLFQPASAPVLFP
QREEWIVPLHTPFTLTCRGEAELAWDTPFYLSEQTEEDNSGLFITTVTVENATAGHTGFY
TCFYKGGNSTEEGEDSSIYIYVPDPEEPFVPSLVPFSNHVLNGHDEMEIQCRVSDPSANV
TLVNTDTQQAVPMTVYDSKRGAVGFFSAGTYVCKALVNGEEHLSEEYIVHGWAGGLELRV
ELKAQKTALFVGDTITVICVARGPEILEDHWKYPGKLADRGLKSVRENKRDQEIQYTLTV
PQASAKDSGIYVCSITDIVSNESQTKELAITVYERPFVSLRPAFSSQESADLDEVRQFQA
DIDSFPSAQVTWLKDGLPLNDVAAEITTSLRQVSETRYQSVLTLIRAKEEDSGNYTIRVQ
NGNQTYSHNFSLQVKVPAVIVDLMDLHHGSGQSVVCIAGGMPTPKVEWFICKNIKLCAND
SSQWVPLPTNNTEITVEAHIDQDNQLESQVIFGHLENTLAVRCLARNEMAAVSREVKLVS
QDPHSELTVAAASLVLLVFVIISLIVLVIIWKQKPRYEIRWRVIESVSPDGHEYIYVDPM
QLPYDSRWEFSRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEK
QALMSELKIMTHLGPHLNIVNLLGACTKSGPTYIITEYCFYGDLVNYLHKNRENFISVHP
EKTKKDLDIFGINPADESNRSYVILSFESGKGDYMDMKQADTTQYVPMLEMSDASKYSDI
QRSEYNHPPSQKGDSEMDNMLSGDDNEGLSTTDLLSFTYQVARGMEFLSSKNCVHRDLAA
RNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNMYTTLSDVWSY
GILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMAKPEHAPTDVYEMMMKCWNSEPEKRP
SFFSLSESVASLLPSGYKRCFERVNHEFLKSDHPAVTRVQVENDDAYVGITYKNQGKSKD
RESGFDEQRLSSDSGYIIPLPDLDPLSDDEYCKRNRHSSQTSEESAIETGSSSTLAKREG
ETLEDITLLDEMCLDSELVEDSFL
NT seq 4395 nt   +upstreamnt  +downstreamnt
atggatgaaatgaagacatgtctcatcattggggtggtcttgtttgggttgttatcggtt
acctgcggactgacgccaccgaccattgtatcaactgaggatgagtttgttctcgagcca
ctctccgttttcaacatcagctgcactagtgaaaggaacgttgcttgggtcgagccctta
ccgaacaacacatttgttttgcctggatattacacggccacgctcttcatctataacgct
tccgtgacacacaccggatattacacctgcaaataccaagacaaagagggcgatgaagag
gacgatgaagaaaatgaggcagtcatatacgtttttgtcccagatcccaaggttccgttc
gtgcctgaggagccaggtagcatggtagttctagtctatcctggtgaaaccatcatccca
tgcagggtctcagaccctcactacccggtggtcctaaagagtgctcccagtggagtagag
gtggacgctgcttatgacaacaagatcggcttcattggcaacttggacgctggactctac
gtctgtgagaccaccgtcaacggcgtgacaatgaccagtgacatctacaccgtggaggac
aacaaactgatggaggacttccatgtggaggtgaaggccagcgaggaggcagtgagactg
gggcaacccttcaacatcacctgtgtggcacctccaggactgccttaccagcagcagtgg
cttcaccccaggaaacaggctgtggatgcagtccagatgaagcagactcttcctgataga
gtggtctacaccctcagtatcccagcagcctcctctcaggacagtggggtgtatgagtgc
tcaatcaccaacaacttcaatggagagatcagagccaacatggtggctgtcactgtcttc
gaggagaactcctttgtgatgttggaccacagtgggatcggagcggtggagtttgtcggt
atgatggaggagacggagttcaccataagtattgaagccttccctgctcctaaagtcacc
tggctgaaagacggcatcgccatcactgagaacagctacttcctcaccaagaccagacgt
ctggtgggcgaccactaccagagcactctgactcttcggcagtcactcgagaaggacagt
gggaattacaccatcgtggtcctcagcagcgctcacattgcccagttctccttcaccctc
aaagtgaaagaatcaggcccagtactgttccagccggcctcagcgccagtgctgttcccc
cagagagaggagtggattgttcccctccacacccccttcaccctgacctgcaggggcgag
gcagagctggcctgggacacgcccttctacctatcagagcagaccgaggaggacaacagc
ggcctgttcatcaccacggttaccgtagagaacgcgacagcagggcacactggcttctac
acctgcttctacaaaggagggaactccactgaggagggagaggacagcagcatctacata
tatgttccagatccagaggagcccttcgtgccctcactggtgccctttagcaaccacgtc
ctgaatggtcacgatgagatggagatccagtgccgtgtgtcggaccccagtgccaatgtg
accctggtcaacactgatacccagcaggccgtgcccatgacggtctacgacagcaagagg
ggtgccgtgggcttcttcagcgcaggaacctacgtctgtaaggccctcgtcaacggagag
gagcacctcagtgaggagtacatcgtccatggctgggctggggggttggagctgcgtgtg
gagctgaaggcccagaagacagccctctttgtgggagacaccatcactgtcatttgtgtg
gcccggggtcctgagatactggaagaccactggaagtaccctggaaaactggcggaccgg
ggcttgaagtcggtgcgcgagaataagagggaccaggagatccagtacacgttgactgtc
ccccaggcctcagccaaagacagcggcatctatgtctgctccatcactgacatcgtcagc
aacgagagccagaccaaggagctggccatcactgtctatgagaggccattcgtgtcgctg
cgcccggcgttcagttcacaggagtcagcagatttggatgaggtcagacagttccaggct
gacattgactcctttcccagcgctcaggtcacatggctcaaagatggcctccctctcaac
gacgtggcggctgaaataaccaccagcctccggcaggtcagcgagaccaggtaccagagt
gttctgaccctgattcgggccaaagaggaggacagtgggaactacaccatcagagtgcag
aatgggaaccagacctacagccacaacttcagcctgcaggtcaaagtgcctgcagtcatc
gtggacctgatggacctccaccatggctcaggccagtctgtagtgtgtatcgctggaggc
atgcccactcctaaggtggagtggttcatctgcaagaacatcaaactctgtgccaacgac
tcgtctcagtgggtgcccctgcctaccaacaacacagagatcactgtggaagcgcacatc
gaccaggacaaccagctggagagtcaggtgatctttggtcatctggagaacaccttggcc
gttcgctgcctggccaggaacgagatggccgccgtcagcagggaggtgaaactggtgtca
caagaccctcactcagagctgactgtagctgctgcttccctggtgctgctggtctttgtc
atcatctcactcattgtcctggtcattatctggaaacagaagcctcgctatgagatccgc
tggagggtgatagagtcagtgagccctgatggccatgagtacatctacgtggaccccatg
cagctgccctatgactccagatgggagttctctcgcgatgggctcgtactgggacgtatc
ctgggctctggggcgtttgggaaggtggtggagggaactgcatacggactcagccgctcc
cagcccgtcatgaaggtggccgtgaagatgctgaaacccacggcccgctccagtgagaaa
caggccctgatgtcagagctgaagatcatgactcacctgggccctcacctcaacatcgtc
aacctgcttggggcctgtaccaagtcaggccccacctacatcatcactgagtactgcttc
tatggagaccttgtcaactacctgcacaagaacagagaaaacttcatcagcgtgcaccca
gagaagaccaagaaagacctggacatctttggcatcaaccctgcagacgagagcaacagg
agctatgtgatcctgtcctttgagagtggtaaaggggactacatggacatgaagcaggca
gacaccacgcagtatgtgcccatgctggagatgagtgacgcctccaagtactccgacatc
cagaggtccgaatacaaccacccgccatcacagaagggtgatagtgagatggacaacatg
ctgtcaggggatgataacgagggcctcagcaccacagacctgctcagcttcacctaccag
gtggccagaggcatggagtttctatcctctaagaactgtgtgcatcgggacctggctgcc
aggaacgtcctgctctctcaggggaagatagtgaagatctgtgactttggcctggccaga
gacatcatgcacgacaacaactacgtctccaaaggcagcaccttcctgccagtgaagtgg
atggctcccgagagtatctttgacaacatgtacaccaccctcagtgacgtctggtcctac
ggcatcctcctctgggagatcttctctctaggtggcaccccatacccagggatggtagtg
gactccagcttctacaacaagatcaagagtggctacaggatggccaaacctgagcacgcc
cccactgatgtgtatgagatgatgatgaagtgttggaatagtgagcctgagaagaggcct
tccttcttcagcctgagtgagagcgtggcctcgctgctgccttccggctacaagaggtgc
ttcgaaagggtgaaccatgagttcctgaagagtgaccacccggcagtgaccagggtccag
gtggagaatgacgacgcctacgttgggatcacctataagaaccagggcaagtcgaaagac
agggagagtggcttcgacgagcagcgcctcagctctgacagtggttacatcatccccctc
cctgacctggaccccctgtctgatgacgagtactgcaagaggaatcgccacagctctcag
acgtctgaggagagtgccatagagacgggctccagctccacgctggccaagagagaagga
gagaccctggaggacatcaccctgctggatgagatgtgtctggactcagagctggtggag
gacagctttctgtga

DBGET integrated database retrieval system