KEGG   Salmo salar (Atlantic salmon): 106584304
Entry
106584304         CDS       T04363                                 

Definition
(RefSeq) zinc finger matrin-type protein 3-like
  KO
K10137  zinc finger, matrin type 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106584304
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-C2H2_2 TUTase zf-U1
Other DBs
NCBI-GeneID: 106584304
NCBI-ProteinID: XP_014024863
UniProt: A0A1S3PB41
LinkDB
Position
ssa23
AA seq 337 aa
MLTPSMSLFGQQQPLFQPMPSTHTLGPPPQTLRPSRPVVVAPDPLLFPLYSPLSAKPPAH
LQLMQGPPCPVPCPVPPPTAQVALSTKPQEEEAQIGATDQDATLDELCKPLYCKLCNVTL
NSAQQAQAHYQGKNHSKKLRNFYAGSQQLPAIRITEVIEPVSQQPLTTAPTESATPKQPV
SFNGASRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEAQQSSSIIESTEC
VQRRPKKEGSEYKLIKNRRTSQVPPAMPAPYYNPRPRQRIPRDLAMCVTPSGQFYCSMCN
SGASEEANFRLHLESKQHKSKVSEQRYRSEMENLGYT
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgctgacgccttcaatgagcctttttggccagcaacagccgctgttccagccaatgcct
tctacacatacccttggaccccctccacagaccctcaggccgtctagaccagtggtagtg
gccccagaccccctccttttccccctctacagccctctgtctgccaaaccacccgctcac
ctccagctgatgcagggccccccctgccctgtcccctgccctgtcccacctcccactgcc
caggtggccctcagcaccaagccccaggaggaagaagctcagatcggggccacagaccag
gacgctaccttggatgagctgtgtaagcctctgtattgcaaactgtgcaacgtcaccctc
aactctgcccagcaggcacaggcccactaccagggtaaaaaccacagtaagaagttgaga
aatttttatgcaggcagccagcagctgcctgccatcaggattacagaggtaatagaacca
gtttcccagcaacccctcacgactgcaccaactgagagtgcaactccaaaacagccggtg
tcatttaacggtgccagcagggtgatcttagccacggagaacgactactgcaagctgtgt
gacgcctcgttcagctcacctgccgtggctcaggcgcactaccagggcaagaaccatgcc
aagagactgcggctggctgaggcccagcagagcagtagcatcatagagtcgactgagtgt
gtccagaggcgtccgaagaaagaggggagcgagtacaaattgatcaagaaccgcaggacc
tcacaggtgcctcctgccatgccagccccctactacaacccccggcccaggcagaggatc
cccagagacctggccatgtgtgtgacgcccagtggccagttctactgctccatgtgcaat
tctggggccagcgaggaggccaacttccgccttcacctggagagcaagcagcacaagagc
aaggtgtcggagcagcgctaccgcagcgagatggagaatctgggctacacttag

KEGG   Salmo salar (Atlantic salmon): 106613932
Entry
106613932         CDS       T04363                                 

Gene name
zmat3
Definition
(RefSeq) zinc finger matrin-type 3
  KO
K10137  zinc finger, matrin type 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106613932 (zmat3)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-C2H2_2 TUTase zf-U1
Other DBs
NCBI-GeneID: 106613932
NCBI-ProteinID: XP_014072236
UniProt: A0A1S3T6L1
LinkDB
Position
ssa10
AA seq 393 aa
MMALHVNNRDAYYQSADYYRNLQPLNYGDSSYYFSRLPGPESMLKPSLSLFGQQQPLFQP
MPPTHTLGPPPQTLGPPPQTLGPPPQTLGPPPPVVVTPDRLRFPLSSPLSATPPAHLQLV
QGPPCPVPCPVPPPTAQATLSSRPQEKDAQIGTTDQDATLEELCKPLYCKLCNVTLNSAQ
QAQAHYQGKNHSKKLRNFYAGSQQPPAIRIPEVIEPLSQQPLTTPPTDSATPKQLVSFMG
ASRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEAQQSSSILESTECVQRR
PRKEGSEYRFIKNRRTPQVPIAVPGPYYNPRPRQRIPRDLAMCVTPSGQFYCSMCNSGAS
EETDFRLHLESKQHKSKVSEQRYRSEMENLGYT
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgatggcgttacatgtcaacaatagagatgcttattatcagagtgccgattattacaga
aatttgcagcctttgaactatggggatagcagctattatttttcccgattaccaggacca
gagtctatgctgaagccttcactgagcctatttggccagcagcagccactgttccagcca
atgcctcctacacatacccttggaccccctccacagaccctcggaccccctccacagacg
cttggaccccctccacagaccctcggaccccctccaccagtagtagtgaccccggaccgc
ctccgtttccccctctccagtcctctgtctgccacaccccccgctcacctccagctggtg
caggggcccccctgccctgtcccctgccctgtcccacctcccactgcccaggcgaccctc
agcagcaggccccaggagaaagatgctcagatcgggaccacagaccaggacgctaccttg
gaggagctgtgtaagcctctgtactgcaaactgtgcaacgtcaccctcaactctgctcag
caggcacaggcccactaccagggaaaaaaccacagtaagaagctgagaaatttctatgca
ggcagccagcagccgcctgccatcaggattccggaggtaatagagccactttcccagcaa
cccctcacgactccaccaactgacagtgcaactcccaaacagctggtgtcattcatgggt
gccagcagggtgatcttagccacggagaacgactactgcaagctgtgtgatgcctcgttc
agctcccctgccgtggctcaggcacactaccagggcaagaaccatgccaagagactgcgg
ctggctgaggcccagcagagcagtagcatcctagagtcgactgagtgtgtccaaaggcgt
ccgaggaaagaggggagcgagtacaggtttatcaagaaccgtaggaccccacaggtgcct
attgccgtgccaggcccctactacaacccccggcccaggcagaggatccccagggacctg
gccatgtgtgtgacgcccagcggccagttctactgctccatgtgcaactctggggccagc
gaggagaccgacttccgccttcacctggagagcaagcagcacaagagcaaggtgtcggag
cagcgctaccgcagcgagatggagaatctgggctacacttag

DBGET integrated database retrieval system