KEGG   Salmo salar (Atlantic salmon): 106584451Help
Entry
106584451         CDS       T04363                                 

Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 1-like
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106584451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ion_trans_2 CD225
Motif
Other DBs
NCBI-GeneID: 106584451
NCBI-ProteinID: XP_014025282
UniProt: A0A1S3PCH3
LinkDB All DBs
Position
ssa23
AA seq 598 aa AA seqDB search
MSEKRGCPFQLLNRAHRDHGGSGGGGSKTFGPNGHATTSLTNPGRSPMGGSQGMGTMDSD
RSLALDEAATAAADSTHYSPVSLKLEPTAVNNGSDTPCSPQTDTKDPPLQIDGRPPAHCP
NPPLPPASQLRSTIHSQSPYVTKTSMQGDVYNFLERPAGLRCFLYHFLVFLMVLVCLIFS
VLSTIEHYADFASGTLFVMEIVLVLFFGTEYVVRLWSAGCRSKYVGIKGRLRFIRKPISI
IDLIVVIASVVVLGVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQ
ELITTLYIGFLGLIFSSYFVYLAEKDAVDEEGKTGFSSYADALWWGVVTVTTIGYGDKIP
QTWIGKCIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTLWR
CYAAEKPEGCPATWKMYVLTRDYIPPINSENNNPNLRNKHTKRKLKMVRDNGSMTILGAR
KMSIPQITFDHIEDNDEKKEVPFFLEEPQGIIRMFRQTGVQHSWSSFNLSCPASPVKKNL
DGPSIGISRGNSLSDDMDYVSEDTPLPVVTDASQWMTGGLWLLLHQASESVSQYSSQR
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagcgaggatgtccctttcagctgctgaaccgtgcgcacagagaccacggt
ggtagtggtggtggaggatccaagaccttcgggccaaatggtcatgccaccaccagcctt
accaacccgggacggagccccatgggtgggagccaaggcatgggcaccatggacagtgac
aggtccctggccctggatgaggctgccactgctgctgctgacagtacacactactctcct
gtttcactgaaactggagcccacagcggtgaataatggatcagacactccctgcagcccg
cagacggacacaaaggacccaccgctgcagatcgacggccggccccctgcccactgccct
aaccctcctctccctccagccagccagctgcgctccaccatacattcccagagcccctac
gtcaccaagactagcatgcagggggatgtctacaacttcctagagagacccgctggattg
agatgcttcctctaccacttcttggttttcctcatggtcctggtgtgccttatcttcagt
gtcctgtccaccatagaacactatgccgattttgccagcggaacactcttcgtgatggag
attgtcctggtgctgttctttgggacagagtatgtggtgcggctctggtctgctggctgc
aggagcaaatatgtggggatcaagggacgactccgcttcatcaggaaacccatttctatc
atagatctgatagtggttattgcctccgtcgtagtgctgggtgtaggctccaatggccaa
gtgtttgccacatctgctatcaggggaatccgcttcctccagattctacgcatgctgcac
gtggatcgtcagggaggaacatggaggcttcttggatcagtagtcttcatccatagacag
gagctgatcaccacgctgtacattggcttcctggggctgattttctcctcctactttgtg
tacctggcggagaaggatgctgtggacgaggagggcaagactgggttctccagctacgct
gatgccctgtggtggggcgtggtgacagtgaccaccattggctacggggacaagattcct
cagacgtggatagggaagtgcattgcctcctgcttcagcgtcttcgccatctccttcttt
gctctgcctgcaggtatactgggctcgggctttgctctgaaggtgcagcagaaacagaga
cagaaacatttcaacagacagatcccggctgcagcctcactaatccagacgctgtggcgc
tgctatgcagcagagaaaccagaaggctgtcctgccacctggaagatgtatgtcctcacc
agagactacattccccccattaactctgaaaacaacaacccaaacctcagaaacaagcac
accaagaggaaactgaagatggttcgtgacaatggctccatgaccatccttggagcgagg
aagatgtccattcctcagatcaccttcgaccacatcgaagataacgacgagaagaaagag
gtccccttctttctagaagaaccccaaggcatcatccggatgttcagacaaacaggcgtt
cagcactcatggtcctctttcaatctgagctgtcctgcctctccagttaagaaaaacctg
gatgggccttccataggcatctcccggggcaacagcttgagtgatgacatggactatgtc
agcgaagacacacctttacccgtggtgacagacgcatcacagtggatgacagggggattg
tggctgctgctgcaccaagccagcgagtcagtcagccagtactccagccagcga

DBGET integrated database retrieval system