KEGG   Salmo salar (Atlantic salmon): 106584490
Entry
106584490         CDS       T04363                                 

Gene name
CDN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106584490 (CDN1B)
   04068 FoxO signaling pathway
    106584490 (CDN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106584490 (CDN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106584490
NCBI-ProteinID: XP_014025335
UniProt: B5X3A2
LinkDB
Position
ssa23
AA seq 190 aa
MSDVRLSNGSPTLERTDARLSDHPKPSACRIIFGSPDREELRRDLKGHLQEMEAAASAKW
NFDFSSHTPLSNGRFKWELMDCKDIPNFYTRTQQSVKDVCPSGNNNMDLNGNHSCVVVTP
RQPTDNTERSESQMESKEQCTGRRKRPACYEYPSSQNKRSHSSSNEVTPCPGLTHSVEKT
PRKASPRTQT
NT seq 573 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgactttcaaatgggagcccgacgttggaaaggacggatgctcggttg
tcggatcaccccaaaccgtcagcctgcagaatcattttcggctcgccggatcgcgaagag
ttaaggcgggatttaaagggacatttgcaggagatggaagcggcggcctcagcgaagtgg
aacttcgatttttcaagtcacacacctctatcgaacgggagattcaaatgggaattaatg
gattgtaaagacattccaaatttctacaccagaacgcaacaatcagtgaaagacgtttgc
ccctctgggaataacaatatggatctaaatgggaatcatagttgtgtggtggtgactccc
cggcagcccactgacaacaccgagaggtcagagagccaaatggagagtaaagagcaatgc
accgggcggagaaaaagacccgcctgctatgaatacccctcgtcccaaaataaaaggtca
cacagtagttcgaatgaagttactccttgcccaggcttgacgcattcagtagaaaaaaca
cccaggaaagccagtcccaggactcaaacgtga

DBGET integrated database retrieval system