KEGG   Salmo salar (Atlantic salmon): 106584598
Entry
106584598         CDS       T04363                                 

Gene name
gtse1
Definition
(RefSeq) G2 and S-phase expressed 1
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106584598 (gtse1)
SSDB
Motif
Pfam: GTSE1_N
Other DBs
NCBI-GeneID: 106584598
NCBI-ProteinID: XP_014025544
UniProt: A0A1S3PD65
LinkDB
Position
ssa23
AA seq 766 aa
MDSHANSEFFSLAEEKFDFDISLSPASSRGDEDDDEVFVGPICHKERCISVGLETSVKEN
VNSWPSVGEGPSWSPLAVDKFEEICTEANLLASQLVVNQQHPDVRVTNGTLALSKEEPKE
DFVQDAGAKLGMFRKPVDAVLSPIKRETFCVQDSPLKQLPPAIQQRLLRDGGGSNSTKSS
VGTSSPVRAGTTTRTKMVRRGRVGLACNTGVLPSKQQPAARGVTAMTALQTAKTRPAPAE
RTTMLAPPSKGNLGLRHSPGSRNSSRAASCEDLLSDTASIASDISDTSLNSSLQGKRTLV
PPSKSGMRAPSAVKAPPQTRRVTDRRRNTSSSSSSVSSFNSSLSVSPTGKGKLSTSLNSS
VSGPNGRLPAGKSRLTNPVVSATKTYRSTLISRAPELPSSTIVARRVISDPGRKLSEQDR
FKMVQSTPLKRVEPAATTTPLHQTPAKMNMERMSSVPNIPTSSSAKTKSIVKGNPKLKVF
IAPTPTSQFKRRLEAVSSPDAPRILKPKRLMSTCSVESLPHKLALPVPELFQTPPAGGNK
AVQPKMRRPSALPTPVNRRISGIPMLTPNSISRPGRPSLSMAILPASIQRASYWSPAQVK
GSHQEDVAAAPEEETVQPFSLEDEPEVQPPIPATVPHPEEQEVCQDDPEPGVDQASPPTN
KQNNHSEPNEESKVLENTEKLLEQPQCNWMKTQDVNEVFLVDAPAPVLRPYEKLLIDLSS
TPVLIRTASAKPSGGQLIDLSSPLIKWSPEVKDHALNEAPLINLSF
NT seq 2301 nt   +upstreamnt  +downstreamnt
atggattcccatgccaacagtgaattcttctcattggccgaagagaagtttgattttgac
atttcactgtcacctgccagctcaagaggagatgaagacgatgacgaggtctttgtgggt
ccgatctgtcacaaggagaggtgtatctccgtcggtctggagaccagtgtcaaggaaaac
gtcaacagttggccttcagtgggtgaggggcccagctggagtcctttggctgtggacaag
tttgaggaaatctgcacggaagccaacctattagccagtcaactagtcgtcaaccagcag
caccctgatgtaagggtaaccaatggtacactcgcattgagtaaagaagaaccgaaagaa
gactttgtgcaggatgctggggccaaactgggcatgttcagaaagccagttgatgctgtg
ctaagccctatcaaaagggagaccttctgtgtgcaggacagtccattgaagcagctccca
cctgctattcagcagcggctgttaagggatggtgggggttctaactccactaagagcagt
gttggcacttccagccctgtgagagcagggactacgactcggacaaagatggtgcgccga
ggcagggtggggctggcctgcaacaccggggtgctccctagcaaacaacaaccagcagcc
agaggagtgaccgcaatgacagccctgcagacagccaagaccagaccggcgcctgctgaa
aggaccaccatgctggctcctccaagcaaaggtaacttggggctgaggcatagcccaggt
agtcgtaactccagcagagcagcctcctgcgaggaccttctctctgacacggccagcata
gcctccgacatcagcgacacctccctcaactccagtctgcaggggaagaggaccctcgta
ccccctagcaagagtgggatgcgggctccgtcagccgtcaaagccccccctcagaccagg
agagtgactgaccggaggagaaacacgtcttcctcctcttcctcagtgtccagcttcaac
tccagtctgtctgtgtcacccacagggaaaggtaaactcagcacgtccctcaactccagc
gtcagtggccctaatggccgcctgcccgctggcaagagccgactcaccaatcctgttgtg
agtgccaccaagacctacaggtctaccctcatcagccgagctccggagctgccctcttcc
accatagtagcgcgccgtgtcatctcagacccgggaaggaagctctctgagcaagaccgg
tttaaaatggttcagtccacccctttgaagagagttgaaccggcggccacaaccaccccc
ttgcaccagaccccagcaaagatgaacatggagagaatgtcctctgtgcccaacatcccc
acctcatcttcagcgaagacgaagagcattgtcaagggcaaccccaaactcaaggtgttc
attgctccaacccctactagtcagttcaagaggaggttggaagctgtttcatcccctgat
gcccctcgcatcttgaagccaaagagattgatgtctacttgcagtgtggaaagtctcccc
cacaaactagcacttccagttccagagctgttccagacgccccctgctggggggaacaag
gcagtgcagcccaagatgagacgcccctctgcccttcccacccctgtgaaccggaggatc
tctggtatccccatgctcaccccgaatagcatttcacggccaggcaggccctccctgagc
atggccatcctgccagcctcaatccagagggccagctactggagtcccgcccaggtgaaa
gggagccaccaagaggacgtggcagcagcaccagaagaggagaccgtccagcccttttcc
ctggaggacgagccagaggtgcagccccccatccctgctacagtcccccatccagaggag
caggaggtatgtcaggatgacccagaaccaggagtggaccaggcgtctcctccgactaac
aagcaaaacaaccactctgagccgaatgaagaatccaaggtgctcgagaacactgaaaag
ctgctagagcagcctcaatgcaattggatgaaaactcaggatgttaatgaggtttttctg
gtagatgccccggcacctgtgttgaggccatatgagaaactcctaattgacctctccagc
actcctgtcctgatcagaacagcctctgcgaagccctctggtggtcagctgattgacctg
agctcgcccctgatcaaatggagtccagaagtcaaggaccatgccttaaatgaagcaccc
ctgatcaacttatccttttga

DBGET integrated database retrieval system