KEGG   Salmo salar (Atlantic salmon): 106584778
Entry
106584778         CDS       T04363                                 

Definition
(RefSeq) p53-induced death domain-containing protein 1-like
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106584778
   04115 p53 signaling pathway
    106584778
SSDB
Motif
Pfam: LRR_8 LRR_4 ZU5 Peptidase_S68
Other DBs
NCBI-GeneID: 106584778
NCBI-ProteinID: XP_014025808
UniProt: A0A1S3PEF2
LinkDB
Position
ssa23
AA seq 577 aa
MEREKKKKWRRGRGQEKTEGENQVGGGTIETGHDPLDQMRNKTVNRITHFPIDKMGHHLG
EEVSRREGQTEGEGETASVSAIRNKEESGIQKGTEKMEEMNKGLITVTDRDNDDGDPVSI
PPSLSISPPSISPLSISTLSSPSPYFLPPLSSSFSPVPSLTPPLPPSVELCAVLTDTRLT
LDVYHGGTAVLQVLWVSVPGQLRGLQYLRLGSEDRGALEGALEVLPHLTQLRSLAIRGHC
FHDAHGDPLPGLLTSLPPSLSSLSLLVHLDLSFNLLSSFPPCLLTLPLLSTLLLGHNHLT
DLPPSFGPLPALRYLSLLGNSLASLPPSMGQLKSLHTLDVSYNLLETLPEEMGALEELVK
LELSHNRLKKLPETMGCLLSLRDLVIHSNDLRVLPVCLCLDKLDKLKVDVRNNPLGRPPT
PPPLPPTPDQVETRVPELHLGLNRHRFCVSSAGCHVFLPGGAELLFPSGCLATTTTLQWA
ERKPDRKWVWLEEHDFLLSRPLELLPHRISFLKPVEVCVPYHRSRRGEVVVRRFDGQQWS
TLPTETRRGSIGHSSHPGGRPARVVYRTQHCFLIWRA
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggagagagagaagaagaagaaatggaggagaggaaggggacaagagaaaacggagggt
gagaatcaagtcggtggtggaaccatagagacgggacatgatcctcttgatcagatgagg
aataagactgtcaacagaataacacactttcccatagataagatgggccaccatcttgga
gaggaagtgtcacgtagggaaggacagaccgagggagagggagaaactgccagtgtgtct
gcaattagaaacaaagaagaaagtggaattcaaaaggggacggagaagatggaggaaatg
aataaaggactgataacagttacagaccgagataacgatgatggggaccctgtctccatc
cctccttctctctccatctctcctccctccatctctcctctctccatctccaccctctca
tccccctctccctacttcctgcctcctctctcctcctcgttctctcccgtcccgtccctc
acccctccccttcccccgtcagtagagctgtgtgcggtgctcaccgacactagactgact
ctggatgtataccacggtgggactgctgtgctccaggtactatgggtgtctgtccctggg
cagctgaggggcctgcagtacctccgactgggctcggaggacaggggggcgctagaggga
gccctggaggtcctaccgcacctcacacagctacgctcactggctattagaggacactgt
ttccatgacgcccatggtgaccccctccccggcctcctcacctctcttcctccctctctc
tcatccctttctctcctcgtccacctggacctctccttcaacctcctctcctccttccct
ccctgcctcctcaccctccccctcctctccaccctcctcctgggtcacaaccacctcact
gatcttccgccctccttcgggcctctccctgccctccgctacctctctctcctggggaac
tctctggcctctctcccccccagcatgggccagctgaagagcctccacaccctggatgtc
tcctataacctcctggagacattacctgaggagatgggtgcgctggaggagctggttaaa
ctggagctgtcacacaacaggctaaagaagctgcctgagaccatgggctgtctcctgtct
ctcagggacctggtgatccacagtaatgacctgcgtgttctccccgtctgtctctgtctg
gacaaactggataagttaaaggtagacgtaaggaacaaccccctgggaagacccccaacc
cctccaccgctaccacccacacctgaccaggtggaaacacgcgttccagagttacacctt
ggactgaatcgacacaggttctgtgtgtcgtctgctggttgtcatgtgttcctcccaggg
ggagcggagctactgtttccctcgggttgcctagcgacgaccaccacgctgcagtgggcg
gagcgtaagccagataggaaatgggtgtggttagaggagcatgacttcctgctgagtcga
ccactggaactcctcccacacaggatctcctttttaaagccagtggaggtgtgtgtaccg
taccaccggtccaggagaggggaggtggttgtgaggaggtttgatggacagcagtggagt
acactacccactgagaccagaaggggcagtataggacacagcagtcaccccggaggacga
cctgccagggtagtgtacagaacacaacactgctttttaatatggcgtgcatga

KEGG   Salmo salar (Atlantic salmon): 106584781
Entry
106584781         CDS       T04363                                 

Definition
(RefSeq) p53-induced death domain-containing protein 1-like
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106584781
   04115 p53 signaling pathway
    106584781
SSDB
Motif
Pfam: Death
Other DBs
NCBI-GeneID: 106584781
NCBI-ProteinID: XP_014025815
UniProt: A0A1S3PDY3
LinkDB
Position
ssa23
AA seq 428 aa
TLQVLQVSVTEVQTLCGDPQARVSPLLCLSQDPSIQFLQPIKVQVPLPTGLAGHTVDLSC
LHLLHGDPSAHTWTDITSQVSLYVTQLYAIFYITHFSWYWLWYTTQRCVSGVVRRVYQRL
KQFQVQFLVLQRRTDPKQVLLQCLPADKVDNRVQSLSEQYDGPQPSDLCDLLEGEQFFAG
FERGLDVSADRPDCAEGRLSFVFYSRLKNLKEVYVCPTQKQEGSIRGQVSFYRGEVPSDI
PQEVARKRKGHDSQWLATLPLRLPGLNSEGGSNGMDWEQPQYPPLNLGDPESGYLTEANL
LAISLQIGQDWRSIGINLGISYQELDRIQYKYRDNLGALVLEMLFHWARGQQQEGVGLRP
AGGPGQKGIGAVPRLVDAMVESDRRDLAEEIKDIVRLGTRKYNESLRRVGLEEEEKRPSA
ETDPSPSH
NT seq 1288 nt   +upstreamnt  +downstreamnt
cactctacaggtgttacaggtgtctgtcactgaggtccagacgttgtgtggagaccctca
ggccagagtcagtcccctcctctgtctctctcaagaccccagcatccaattcctccagcc
aatcaaggtgcaggtccctctgccgactggactcgctggtcatacagtagacctgtcctg
tctccacctgcttcatggagaccccagcgcccacacctggacagacataacctcacaggt
gtccctctacgtcacccagctgtacgctatcttctacatcactcacttctcctggtactg
gctgtggtacactacccagcgctgtgttagcggtgtggtccgtagggtctaccagagact
gaagcagttccaggttcagttccttgtgctacagaggagaacagaccccaaacaggttct
gctacagtgcctgcctgctgacaaggtggacaacagagtacagtctctgtcagagcagta
cgatggcccacaaccctcagacctctgtgacctgttggagggagagcagttcttcgctgg
cttcgagaggggcctagacgtcagcgcagatagaccagactgtgcggaagggagactgtc
gtttgtgttctactctcggttgaagaatctcaaagaggtgtacgtttgtcctacacagaa
gcaggaggggtcaatcaggggtcaggtgtctttctatcgaggggaggttcccagtgacat
accacaggaagtggccaggaaaaggaaaggacatgacagccaatggctggccactttacc
actcagacttcctggcctaaactcagagggtggtagtaatggtatggactgggagcagcc
ccagtaccctccattgaacctgggagacccagagagcgggtacctgactgaggctaacct
gctggccatctccctgcagatcggacaggactggaggtccatcggcatcaacctgggaat
cagctaccaggagctggaccgcatacagtacaaatacagagacaacctaggggccctggt
gttggagatgctgttccactgggcccggggtcagcagcaggagggtgttgggttgcgtcc
cgctggaggtccaggccagaagggtattggtgcagtgcccaggttggtagatgccatggt
ggagagcgacaggagggacctggctgaggagattaaagacatagtgaggctaggaacccg
gaagtataatgagtcactgaggagggtgggcctagaagaggaagagaagaggccttcagc
agaaacagatccctcaccttcacactga

DBGET integrated database retrieval system