KEGG   Salmo salar (Atlantic salmon): 106584797Help
Entry
106584797         CDS       T04363                                 

Gene name
D6fad_b
Definition
(RefSeq) fatty acid desaturase 2-like
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00592  alpha-Linolenic acid metabolism
sasa01040  Biosynthesis of unsaturated fatty acids
sasa01100  Metabolic pathways
sasa01212  Fatty acid metabolism
sasa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    106584797 (D6fad_b)
   01040 Biosynthesis of unsaturated fatty acids
    106584797 (D6fad_b)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    106584797 (D6fad_b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sasa01004]
    106584797 (D6fad_b)
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     106584797 (D6fad_b)
Lipid biosynthesis proteins [BR:sasa01004]
 Desaturase
  Front-end
   106584797 (D6fad_b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase Cyt-b5 GH-E Peptidase_M42
Motif
Other DBs
NCBI-GeneID: 106584797
NCBI-ProteinID: XP_014025869
UniProt: A0A1S3PEL1
LinkDB All DBs
Position
ssa23
AA seq 280 aa AA seqDB search
MGGGGQQTESSEPAKGGVVGPGGGRGGRGGSAVYTWEEVQRHCHRGDQWLVIDRKVYNIT
QWAKRHPGGIRVISHFAGEDATDAFSAFHPDPNFVRKFLKPLLIGELAPTEPSQDQGKNV
RRYQSLSPVKDLAWSMSFYLRFFCCYYPFFGFFGSVALISFVRFLESHWFVWVTQMNHLP
MEMDHERHQDWLTMQLSATCNIEQSTFNDWFSGHLNFQIEHHLFPTMPRHNYHLVAPLVR
ALCEKHGVPYQVKTMQQGLTDVVRSLKKSGDLWLDAYLHK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggggggcggaggccagcagacggagtcaagcgagccggccaagggtggcgtggttggg
cccggtggagggcgaggagggcgaggtggcagtgcagtctacacctgggaagaggtccag
aggcactgccacagaggcgaccagtggttggtcatcgacaggaaggtctataatattacc
cagtgggcaaagagacacccgggtggcatcagggtcatcagtcactttgctggagaagat
gccacggacgcattttccgcattccatcctgatcctaattttgtcaggaagtttctgaag
ccgttgctgattggagagctggcaccgacagagcccagccaggaccaggggaaaaatgtg
aggagataccaatctttgtctcctgtgaaggatctggcgtggtcgatgagtttctacctt
cgcttcttctgctgttactatcccttctttggtttctttggctcagtagcattgatcagc
ttcgtcaggtttttggaaagccactggtttgtatgggtgacccagatgaatcaccttcct
atggagatggatcatgagagacaccaggactggctcaccatgcagttgagcgctacttgc
aacattgaacagtcaaccttcaacgactggttcagtggacacctcaactttcagattgaa
caccatctgtttcctaccatgccccgtcataactaccacctggtggctcctctggttcgt
gctttgtgtgagaaacatggagttccctatcaggtcaagaccatgcagcaaggcctcact
gatgttgtcaggtcactgaagaagtcaggggatctgtggctggatgcatatctccataaa
taa

DBGET integrated database retrieval system