KEGG   Salmo salar (Atlantic salmon): 106584815
Entry
106584815         CDS       T04363                                 

Gene name
ddb2
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa03420  Nucleotide excision repair
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106584815 (ddb2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    106584815 (ddb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106584815 (ddb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sasa04121]
    106584815 (ddb2)
   03400 DNA repair and recombination proteins [BR:sasa03400]
    106584815 (ddb2)
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     106584815 (ddb2)
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      106584815 (ddb2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 106584815
NCBI-ProteinID: XP_014025888
UniProt: A0A1S3PDX7
LinkDB
Position
ssa23
AA seq 501 aa
MARAKKAPSEASESKQKSRKQNGETSGAAGQTISKKLQQKMDGKTTLRTGPVLPTTMTKS
SVGKRSGPGSILHYIYQSTLGQSLHSQMRQCLQKPFVRTLSSYTLHRTASPFDRRVTCLA
WHPSHPTTLAVGSKGGDVVLWDYSVINKTSFIQGVGPGGSITALKFNPYNPTQLFTSSVR
GTTTLQDFNGTTLRVFTNTESWDLWYCCVDVSLSRQMLVTGDNIGRVLLLGMDGHQVFNE
KLHKAKVTHAEFNPRCDWLMATASVDHTVKLWDLRNIKDKNSYLHEMVHDKAVNSAYFNP
VDCSKLLTTDQYDQIRVYSSSDWSTPQRIIQHPHRQFQHLTPIKASWHPLYDLMVVGRYP
DERVCPGALRTIDIYDANTGELACQLLDPNAPGIISVNKFNPMGDVLGSGMGVNILVWNR
SETFAGKQQRGELQQEAGFQVGRGRGQRRRRGEARRRGEGRGEDEDDIGKLKKKLSSSSA
TRTRTSRDKQHNSQTQKGPDK
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggcacgggcaaagaaggctccttcagaagcgtctgaatcgaagcagaagtcgaggaag
cagaatggagaaacgtctggggccgcaggacaaaccatctccaagaagctacagcagaag
atggacgggaagaccacattgagaacagggcctgttttaccaaccaccatgaccaaatct
tcagttgggaaaagaagtggaccaggaagcatcctgcactacatttaccagagtacactg
gggcagagccttcattctcagatgagacagtgtctccagaagccgtttgtacgtaccctg
tcctcctatacgctccaccgtacagccagtccgtttgaccggcgggtcacctgtctggcg
tggcacccctcacaccccaccaccctggcggtaggctccaagggaggagacgtagtcctc
tgggactacagcgtgatcaacaagaccagcttcatacaaggggttggtcctggaggctct
attacagctctgaagtttaacccttacaaccccactcagctgttcacctcatctgtcagg
ggaaccaccacgctgcaggatttcaatgggaccactctccgcgtgtttaccaacacagag
tcatgggatctgtggtattgctgtgtagatgtgtcgttgagcagacagatgctggtgaca
ggagacaacataggacgagtcttattgctgggcatggatggacaccaggtcttcaacgag
aagttacacaaggctaaagtgacccatgctgaattcaaccctcgctgcgattggttaatg
gcgacagcgtctgttgaccacacggtgaagctgtgggacctgaggaacatcaaagacaag
aacagttacctccacgagatggttcatgacaaagctgttaactcggcctactttaatcca
gtggactgctccaagctcctgaccacggaccagtatgaccagatcagggtgtactcctct
tctgattggtcaactcctcagcggattatccagcacccacacagacaatttcagcacctc
acacctatcaaggcctcgtggcaccctctgtacgacctgatggtggttggacggtaccct
gacgagagggtgtgtccaggtgccctgaggaccatcgatatctacgatgccaacacagga
gagctggcatgccaactactggaccccaacgcccctggcatcatatctgtcaacaagttc
aatccaatgggagatgttttaggatctggaatgggagtgaacatcctagtgtggaacaga
agtgagacatttgctggtaagcagcagagaggagagctacaacaggaagcaggattccag
gttggcagaggtagaggccagcggaggagaagaggagaggctcggaggaggggggaggga
cggggggaggatgaggacgacattgggaagctgaagaagaagttgtcttcctcctcggcg
accagaaccagaacatccagggacaaacagcacaacagccagacacagaagggtccagat
aaataa

DBGET integrated database retrieval system