KEGG   Salmo salar (Atlantic salmon): 106585167Help
Entry
106585167         CDS       T04363                                 

Definition
(RefSeq) glucokinase-like
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00010  Glycolysis / Gluconeogenesis
sasa00052  Galactose metabolism
sasa00500  Starch and sucrose metabolism
sasa00520  Amino sugar and nucleotide sugar metabolism
sasa00524  Neomycin, kanamycin and gentamicin biosynthesis
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
sasa04910  Insulin signaling pathway
Module
sasa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sasa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106585167
   00052 Galactose metabolism
    106585167
   00500 Starch and sucrose metabolism
    106585167
   00520 Amino sugar and nucleotide sugar metabolism
    106585167
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106585167
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106585167
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     106585167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Poty_PP
Motif
Other DBs
NCBI-GeneID: 106585167
NCBI-ProteinID: XP_014026550
UniProt: A0A1S3PFZ8
LinkDB All DBs
Position
ssa24
AA seq 478 aa AA seqDB search
MLCVSSFVGQMGKMPCSLSSVLETVLMVEQILSEFRLKKEQLKEVMKRMMREMDRGLRVE
THQEASVKMLPTYVCSTPEGSEVGDFLALDLGGTNFRVMLVKVGEDEERGWKVETKHQMY
SIPEDAMTGTAEMLFDYIAECISDFLNRQHIKHKKLPLGFTFSFPVRHENIDKGILLNWT
KGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGT
GCNACYMEEMRTVELVEGEEGRMCVNTEWGAFGANGELEEFRLEYDRVVDETSLNPGQQL
YEKLISGKYMGELVRLVLLKLVNEELLFNGEASALLKTRGSFETRYVSQIESDSGDRKQI
YNILSTLGVLPSELDCDIVRLACESVSTRAAHMCGAGLAGVINRMRERRSQAVLKITVGI
DGSVYKLHPCFQDRFHKVVRELTPHCDITFIQSEEGSGRGAALISAVACKMAACMLTP
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcgtcagctccttcgtgggccagatggggaagatgccttgtagcctcagctct
gtgctagagacagtcctcatggttgagcagatcctgtcggagttcaggctgaagaaggag
cagttgaaggaagtgatgaagaggatgatgagggagatggaccggggactgcgtgtagag
acgcaccaggaggccagtgtcaaaatgctgcccacctacgtctgttctacccctgaagga
tcagaggtgggggatttcctggccctggacctgggggggactaacttccgtgtgatgtta
gtgaaggtgggggaggatgaggagaggggatggaaggtggagaccaaacaccagatgtac
tccatccctgaggacgccatgacaggcacggctgagatgctctttgactacattgctgag
tgtatatcagacttcctgaacagacaacacatcaagcacaagaagcttcctctgggtttc
actttctcctttcctgtacgacacgagaacatagacaagggcatcttactgaactggacc
aaagggttcaaggcgtctggagcagagggtaacaacgtggtgggactactgagagatgcc
atcaagaggagaggggactttgagatggacgttgttgccatggtgaacgatacagttgcc
accatgatatcttgttactatgaggaccgcagctgcgaagtgggaatgattgtgggtact
gggtgtaacgcttgctacatggaggagatgcggacagtggagctggtggagggggaagag
gggaggatgtgtgtgaacacagagtggggggcatttggagccaacggagagctcgaggag
tttagactggagtacgacagggtggtggacgagacatcactcaaccctggacaacaactc
tatgaaaagctcatcagtgggaagtacatgggagagctggtgcggctggtattgttgaag
ctggtgaacgaggagttgctgtttaacggagaggcctctgccctgctgaagactcgcggc
agctttgagacgcgctacgtctcccagatagagagtgactctggagacaggaagcagatc
tacaacatcctgtctacgctgggcgtgttgccgtcggagctggactgtgacattgtgcgc
ctagcttgtgagagcgtgtccacgcgggcagcacacatgtgtggggcggggttagccggc
gtcatcaaccgtatgagagaacgccgcagccaggcggtgttgaagatcactgtgggcatc
gacggctccgtctacaaactccacccctgtttccaggacaggttccacaaagttgtgcgg
gagctgacgcctcactgtgacatcaccttcatccaatcagaggaagggagtggccggggg
gcggcacttatctcagcagtagcctgtaagatggcagcgtgcatgctgacaccgtga

DBGET integrated database retrieval system