KEGG   Salmo salar (Atlantic salmon): 106585418Help
Entry
106585418         CDS       T04363                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00590  Arachidonic acid metabolism
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106585418
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     106585418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 106585418
NCBI-ProteinID: XP_014027069
UniProt: A0A1S3PI49
LinkDB All DBs
Position
ssa24
AA seq 598 aa AA seqDB search
MRECFVCVWAFILLLRLPTCPGEEIKDVSANVVNPCCYYPCQNWGVCLRFGTDRYECDCT
RTGFYGQNCTIPEFWTRVYLKLKPSPDVVHYILTHFHWLWSLINRTFLRDWLMRVVLTVR
ANLIPSPPTFNSKYGYLSWESYSNVSYYTRILPPVPEDCPTPMGAKGKSVLPDPKLVVEK
FLLRRKFRPDPQGTNLMFAFFAQHFTHQFFKTQNSMGLGFTRALGHGVDAGNVYGDNLVR
QLNLRLLKDGKMKYQVIKGEVYPPTVAEAPVNMSYPRGVPEGQRMAIGQEVFGLLPGLTL
YATLWLREHNRICDILKAEHPTWGDEQLFQTTRLIVIGETIRIVIEDYVQHLSGYLLDLK
FDPVLLFKSTFQYRNRIAVEFNQLYHWHPLMPDSFHIDGDVVLYSQFIFNTSIVTHYGVE
KLVDAFSRQCAGQIGGGKNIHPVVTKVAEGVIEESRALRLQPFNEYRKRFNLRPYTSFSD
FTGEEEIARELEELYGDIDALEFYPALMLEKTRPNAIFGESMVEMGAPFSLKGLLGNPIC
SPEYWKPSTFGGQTGFDIVNSASLERLVCLNSKWCPYVAFSVPPAGQEPPPRKPSTEL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgagagagtgcttcgtgtgcgtatgggcgtttatcctgctgctaaggttaccaacatgt
ccaggggaagagatcaaagacgtctctgcgaatgttgtgaatccctgttgctattacccc
tgtcaaaactggggtgtgtgtttaaggtttggcactgaccgctatgaatgtgactgcact
cgcactggcttctatggacagaattgcactatccctgagttctggacaagggtctacctg
aagctgaagccgagccctgatgtggtccactacattctcacacacttccactggctgtgg
agcctcatcaacaggaccttcctacgggactggctcatgagggtggtcctcacagtcaga
gcaaaccttattcccagtcctcctaccttcaactcaaagtatggatacctcagctgggaa
tcctactccaatgtctcctattacacccgtatcctaccgcctgtgcctgaagactgcccc
acccctatgggtgccaaaggaaagtctgtcctcccagacccaaagctggtggtggagaag
tttctgctgaggaggaagttcaggccagatccacagggaaccaacctgatgtttgctttc
ttcgctcagcatttcacccatcagttcttcaagactcaaaacagcatgggcctgggcttc
accagggcgctggggcatggggtggatgccggcaatgtttacggcgataatctggtgcgt
caactgaacctccggcttcttaaagacggaaagatgaaataccaggtaattaaaggtgag
gtgtaccctccaacggtagcagaggcgccggtgaatatgagctaccctcgaggggttcca
gaggggcagcgcatggccattgggcaggaggtgtttgggctgctgccaggcctcaccttg
tacgccaccctgtggctgagagaacacaaccgcatctgtgacatcctgaaggccgagcac
cccacctggggggatgagcagctcttccagaccaccaggctcatcgtcataggtgagact
atccggatagtgatcgaggactacgtgcagcacctgagcggctacctgttggatctgaag
ttcgatccggtcctgctcttcaagtccacgttccagtacaggaaccgcatcgctgtggag
ttcaaccaactataccactggcaccccctgatgccagacagcttccacatagacggagac
gtggtgctctactcccagttcatcttcaacacctccatcgtcacacactacggggtggag
aaactggtggacgctttctcacgccagtgtgctggacagataggaggtgggaagaacatc
cacccagtggtgaccaaggtggccgagggtgttattgaagagtccagggctctgcgtctc
caacccttcaacgagtacaggaagaggttcaacctgaggccctacacatctttctctgac
ttcactggtgaggaggagatagccagggagctggaggagctctatggtgacatcgatgcg
ctggagttctaccctgccctcatgctggagaagacacgccccaacgccatatttggcgag
agcatggtggagatgggggctccgttctccctgaaaggccttctgggtaacccgatctgt
tcccctgagtactggaagcccagcacgttcggaggccagacaggctttgatatagtcaac
tcagcctcgctggagagactggtgtgtctgaacagtaagtggtgtccgtacgtagccttc
agtgtgcctccagccgggcaggagccgccgccaaggaaaccgtccactgaactgtaa

DBGET integrated database retrieval system