KEGG   Salmo salar (Atlantic salmon): 106587025Help
Entry
106587025         CDS       T04363                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, mitochondrial
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00020  Citrate cycle (TCA cycle)
sasa00310  Lysine degradation
sasa00380  Tryptophan metabolism
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
Module
sasa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sasa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sasa_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:sasa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106587025
  Amino acid metabolism
   00310 Lysine degradation
    106587025
   00380 Tryptophan metabolism
    106587025
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     106587025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 106587025
NCBI-ProteinID: XP_014030341
UniProt: A0A1S3PRS0
LinkDB All DBs
Position
ssa26
AA seq 1033 aa AA seqDB search
MHRLRTCAARLRPLTASQTAQNFSQQRRAAVPRTFQPFRCYTAPVAAEPFLNGTSSNYVE
EMYYSWLEDPKSVHKSWDVFFRNANAGAPPGMAHQSPLSLAGLPQAQSLAGAQPNVEKLV
EDHLAVQSLIRAYQIRGHHVAQLDPLGIMDADLDSHVPNDIITSSDKLDLAMFKDRLSIL
TVGGFYGLDESDLDKVFRLPTTTFIGGTETALPLREIIRRLEMAYCQHIGVEFMFINDLD
QCQWIREKFEKPGVMQFTLEEKRTLLARMVRSTRFEEFLQRKWSSEKRFGLEGCESLIPA
LKTIIDKSSEKGVENVVMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKY
HLGMYHRRINRVTDRNITLSLMANPSHLEAVDPVVQGKTKAEQFYCGDTEGHKVMSILMH
GDAAFAGQGVVYETFHLSDLPSYSTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVN
APIFHVNADDPEAVVYVCNVAAEWRATFHKDVVVDLVCYRRLGHNEMDEPMFTQPLMYKQ
IKKQKGVMQKYGEKLIAEGVVTRQEYEEEIAKYDKICEEAHVRSKDEKILHIKHWLDSPW
PGFFNLDGQPKSLTCPSTGLTEEELTHIGQVASSVPVEDFTIHGGLSRILKARGEMIKNR
TVDWALGEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRVCIPMNHVAPN
QAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKW
VRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPSITEDFAIRQLHDCNWIVV
NCSNPGNFFHVLRRQILAPFRKPLIVFTPKSLLRHPEARSNFDEMLPGTDFQRLIPDNGP
VAQNPAGVKRIVFCTGKVYYELTKERKAHGMEDTVAIARMEQLSPFPFDLVKAESEKYPN
ADLVWCQEEHKNQGYYDYVKPRMRTTIDRAKPVWYAGRPPAAAPATGNKKAHLVELKNFL
DTAFDLDAFKDQM
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcttaaggacttgtgctgcccggctgcggccgctgacagcctctcagactgct
cagaacttttcacagcagaggcgtgcggccgtaccaaggacttttcagccatttaggtgc
tacaccgcacctgtggctgccgagcctttcctcaatggaacaagctccaattatgtggag
gagatgtactattcatggctagaggaccccaagagtgttcataagtcttgggacgttttc
ttccgcaatgccaatgcaggtgctcccccaggcatggcccaccagagccctctgagcctg
gccggtctccctcaagcccagtctttggcgggggctcagcccaatgtggagaagctggtg
gaggatcacctggctgtccaatccctcattcgtgcctaccagatccgtgggcaccatgtt
gctcagctggacccgctggggattatggatgccgatctggactctcacgtccccaatgac
attataacgtcctcggataaactcgatctggcaatgttcaaggaccgtctcagtattcta
actgtcggagggttctatggactggacgagtcggacttggacaaagtgttccgcctgcct
accaccacctttatcgggggcactgagaccgccttgcccctgagggagataatccgccgc
ctggagatggcctactgccagcacatcggggttgagttcatgttcatcaatgacctagac
cagtgccagtggatccgggaaaagtttgagaagcccggcgtcatgcagttcaccctggag
gagaagaggaccctgctggcccgtatggttcgctccaccaggttcgaggagttcctccag
aggaagtggtcgtcagagaagcgcttcggcctggagggctgcgagtctctgatccccgcc
ctcaagaccatcattgacaagtccagcgagaagggtgtggagaacgtcgtcatgggcatg
ccacacaggggtcgtctgaacgtgctggccaacgtcatccgcaaggagctggagcagatc
ttctgccagtttgactccaaactggaggctgctgatgagggctctggtgacgtcaagtac
cacctggggatgtaccacaggaggatcaaccgtgtgacggaccgcaacatcactctgtcc
ctcatggccaacccctcccacctggaggctgtggaccccgtggtgcagggcaagaccaag
gccgagcagttctactgcggagacaccgagggacacaaggtgatgtccatcctgatgcac
ggtgatgctgccttcgccggtcagggcgtcgtgtacgagaccttccatctcagcgacctg
ccgtcctactccacccacggcacagtgcacgtggtcgtcaacaaccagattggcttcacc
actgacccccgtatggcgcgctcctctccgtaccccactgatgtggcccgggtggtcaat
gctcccatcttccacgtgaatgctgacgaccctgaggctgtggtgtacgtgtgcaacgtg
gccgccgagtggagagccaccttccacaaggacgtggtggtggacctggtgtgctaccgg
cggttgggacacaacgagatggacgagcccatgttcacccagcccctgatgtacaagcag
atcaagaagcagaagggagtgatgcagaagtatggcgagaaactcatcgcagagggggtt
gtcacgagacaggagtacgaggaggagattgcaaagtatgataagatctgtgaggaggca
catgttcgctccaaggatgagaagatcctccacatcaaacactggctggactctccctgg
cctggttttttcaacctggatggccagcccaagagcctgacctgcccgtccactggcctg
actgaggaggagctgacccacatcggacaggtggcctcctcagtgccagtcgaagacttc
accatccatggaggtctgagccgtatcctgaaggcccgaggggagatgatcaagaaccgc
acggtggactgggccctgggagaatacatggcctttggctctctgctcaaagagggcatc
cacgttcgcctcagcggccaggacgtggagaggggcaccttcagtcaccgacaccatgtg
ctgcacgaccagaacgtggacaagagagtttgcatccccatgaaccacgtggcccccaac
caggccccctacaccgtctgcaacagctccctgtctgagtacggcgtgctgggtttcgag
ctgggctttgccatggccagtcccaatgccctggtcctgtgggaggcccagttcggagac
ttccacaacacagcccagtgcatcatcgaccagttcatttgccccggccaggccaagtgg
gtccgccagaatggcatagtcctgctgctgccccacggcatggagggcatgggcccagaa
cactcctctgctcgtccagagagatttctccagatgtgcaacgatgatcctgatgtgctc
ccaagcatcacagaagactttgccattcgccagctccacgactgcaactggattgtggtc
aactgttcaaaccctggcaacttcttccacgtgctgaggaggcagattctggcgcctttc
aggaagcctctcatcgttttcacccccaaatccctgctgcgccaccccgaggcgaggtcc
aactttgacgagatgctgccaggcacagacttccagcgcctgatcccagataatggccca
gtggcccagaacccagccggggtgaagcgcatcgtcttctgcacagggaaggtgtactac
gaactcaccaaggaacgcaaggcccatggcatggaggacacggtcgccattgctcgcatg
gagcagctgtcccccttccccttcgacctggtgaaggctgagagcgagaagtaccccaat
gccgacctggtgtggtgccaagaggagcataagaaccagggctactacgactacgtcaaa
ccccgcatgcgcaccaccatcgatcgcgccaagcctgtctggtatgctggtcgccctcct
gctgcggccccagccacaggaaacaagaaggcccacctggtggagctgaagaatttcctg
gacactgccttcgatctggatgccttcaaggaccagatgtaa

DBGET integrated database retrieval system