KEGG   Salmo salar (Atlantic salmon): 106587736Help
Entry
106587736         CDS       T04363                                 

Definition
(RefSeq) mitogen-activated protein kinase 6-like
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106587736
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106587736
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106587736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 106587736
NCBI-ProteinID: XP_014031818
UniProt: A0A1S3PVU2
LinkDB All DBs
Position
ssa26
AA seq 791 aa AA seqDB search
MAEKFESLMNIHGFDLGPRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIILTDPQSVK
HALREIKIIRRLDHDNTVKVFETLGPSGRHLTEDIVSLTEVNSVYIVQEYMETDLCQLLE
RGLLSEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVLREEDRQELHSVIPVFIHGDMSQPHNPLAKLLPDVSPHALDFLQKILTFN
PMDRLTAEEALAHPYMSDYSFPLDEPVSLHPFHIEDEVDDILLMDQGHSHTWDRYHDSQL
SEGDWHLHTHSTLDTDEVQVDPRALSDQTDEEEVQVDPRKYADGDREFLDDPSYGYSSLF
TPERSWPDPDDEHFDLHHENKYCDLECSHTCNYKVVSPSYLDNLIWRDSEVNHYYEPKLI
IDLSNWKEQQSKEKQAQAAGRDKEHKAQKSKCEKNGLVKAQMVLQVEKSPVEKDSQQEKN
QTQTTQQNQGFDFDSFIAGTIKLSLQTEPSDVGLLGDVGLLSEVGVGLLSEVGLLNELNS
SVSQLEAPRSGSMSKTISQEKEEKCLVNFAQVSITVGTAGSGARPAHPWESFGGGERVEE
RRGGCLMDGAGRWDVGKEEQLQKDSSYTSYLDRLFSRKDEGSGETAASAADTPEPEPSDV
GGERERDEGGFLARSGEIMFNMQLDSLALPGFDATTDVPLKSIQASLAPSTVKCSPQIAH
TTYSSFFKHLN
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaagtttgagtctctgatgaacatccatgggtttgacctcggcccacgttac
atggacctgaagcctctgggctacggagggaacggcctggtgttctcagccgtcgacacg
gactgcgacaaacgcgtggcggtgaagaagatcatcctgacggacccgcagagcgtcaaa
cacgccctgagagagatcaagatcatcaggaggctggaccacgacaacaccgtcaaggta
tttgagactctagggcccagcggtcgccacctaacagaggacatagtctctctgacagag
gtgaactctgtgtacatcgtccaggagtacatggagacagacctgtgtcagctcctggag
aggggtcttctctctgaggaccacgccagactcttcatgtaccagctgctgagaggcctc
aagtacatccactctgccaatgtactgcacagagacctgaagcctgccaacttgttcgtc
aacacagaggacctggtgctgaaaataggagactttgggctggcccggatcatggatcct
cactactcacacaagggtcatctttctgagggcttggtgactaaatggtaccggtctcct
cgcctgctgctctccccaaacaattacaccaaggccattgacatgtgggctgctggatgc
atcttcgccgagatgctcaccgggaaaacgctcttcgcaggagcacatgagctggagcag
atgcagctgatcctggagtccatccctgtgctgagagaagaggacaggcaggagttacac
agtgttatccccgtcttcatacacggtgacatgtcccagccgcacaacccactggccaag
ctactgcctgacgtcagcccacatgccctggatttcctgcaaaagatcctgacctttaac
cccatggaccgtctgacagcagaagaagccctagcccacccctacatgtctgactactcc
ttccccctggacgaacccgtctccctgcaccccttccacatagaggatgaggtggatgat
atcttactgatggaccagggtcacagccacacctgggacaggtaccatgacagccagctt
tcagaaggggactggcacctccacacccacagcactctggacactgacgaggtacaggtg
gaccctcgggctctgtctgaccaaactgacgaggaggaggtccaggtggaccctcgtaag
tatgcagacggagaccgggagttcctggacgatccttcctacggctactcctccctcttc
actcccgaacgctcgtggcccgaccccgatgacgaacacttcgaccttcaccacgagaac
aagtactgtgacctggagtgttcccacacctgtaactacaaggtggtgtctccatcctac
ctggataacctgatctggagggacagcgaggtcaaccactactacgagcccaagctcatt
atagatctgtccaactggaaggagcagcagagtaaagagaaacaggctcaggctgcaggc
agagacaaggagcacaaggcccagaagagcaagtgtgagaagaacggcctggtgaaggct
cagatggttctacaggtagagaagagccccgtagagaaggactcccagcaagagaagaac
cagacccagactactcaacagaatcaaggctttgactttgactccttcatcgccggcacc
atcaaactgagcctgcaaactgagcccagcgacgtgggactcctgggggacgtgggcctc
ctgagcgaggtgggagtgggcctcctgagcgaggtgggcctcctgaacgagctcaactcg
tctgtgtcccagctggaggctccgcggtcaggctccatgtccaaaaccatcagccaggag
aaggaggagaagtgtctggtgaactttgctcaggtcagcatcaccgtggggaccgctggg
tctggggcgcgtcccgcacacccctgggagagcttcggagggggggagagggtagaggag
cggagaggtgggtgtctgatggacggggcggggcgctgggacgttgggaaagaggagcag
ctccagaaggacagctcctacaccagctacctggacagactgttcagcaggaaggacgag
ggcagcggggagactgctgctagcgccgccgacaccccagaacctgagccctcggatgtg
ggaggggagagggaacgggacgaggggggcttcctggcgcggagcggagaaatcatgttt
aacatgcagctggactctctggcgctgccggggttcgacgctacgaccgatgtgccgctc
aaatccatccaggcctccctcgctccctccacggtcaaatgctcgcctcagatcgcccac
acaacctacagcagcttcttcaagcatctgaattaa

DBGET integrated database retrieval system