Salmo salar (Atlantic salmon): 106587984 Help Entry 106587984         CDS       T04363                                  Name (RefSeq) CD82 antigen-like   KO K06509   CD82 antigen Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04115   p53 signaling pathway Brite KEGG Orthology (KO) [BR:sasa00001]  09140 Cellular Processes   09143 Cell growth and death    04115 p53 signaling pathway     106587984  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106587984    04090 CD molecules [BR:sasa04090]     106587984 Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106587984   Exosomal proteins of other body fluids (saliva and urine)    106587984   Exosomal proteins of colorectal cancer cells    106587984 CD molecules [BR:sasa04090]  Proteins   106587984 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tetraspanin Motif Other DBs NCBI-GeneID:  106587984 NCBI-ProteinID:  XP_014032119 UniProt:  A0A1S3PWP5 LinkDB All DBs Position ssa26:42414790..42446991 Genome browser AA seq 135 aa AA seqDB search MGKGCMKAIKYFLFLFNVLFFLFGALIMGFGLWVLLDNESFMVILQESSTVLKIASYILI GVGGLSMLMGFLGCLGAIYEIRCLLGLYFTCLLLILIGQVAAGVLIYFQKDLVSDVTSCL HLLVAFRKEKLTECS NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggggaaaggctgcatgaaggcaatcaagtacttcctgttcctcttcaatgtcctcttc ttcctgtttggcgccctcatcatggggttcggactgtgggtccttctggacaatgagagc ttcatggtcatcctgcaagagtcctccacagtgctgaagatagcttcctacatcctgata ggtgtaggtggtctctccatgttgatgggcttcctgggctgcctgggggctatctacgag atccgctgtctgctgggcctgtacttcacatgcctgctgctgattctgattggtcaggtg gcagccggtgtactcatctacttccagaaggacctggtgagtgatgtcacttcctgttta cacctgttggtcgcgttcaggaaagagaaacttactgaatgtagctga

DBGET integrated database retrieval system