KEGG   Salmo salar (Atlantic salmon): 106588375
Entry
106588375         CDS       T04363                                 

Gene name
ATF6
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04141  Protein processing in endoplasmic reticulum
sasa04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106588375 (ATF6)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106588375 (ATF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106588375 (ATF6)
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    106588375 (ATF6)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA HAUS6_N MCU CENP-H DUF4140 ATP-synt_B
Other DBs
NCBI-GeneID: 106588375
NCBI-ProteinID: XP_014032758
UniProt: A0A1S3PYG8
LinkDB
Position
ssa27
AA seq 726 aa
MTTDLLSDLDTRFFADNLLTSEDWDACLYQCESMEEGEDGEYTRGPKYETSFDNDLVLTL
DPDNPTSPWRHLDDNLLTVFRVKAEPPSPASSLASDCSLTSLPDSQITVKGENPPTPPYM
FGDVLSPPLGTCEVTVASAQLSRPQSKLPPQQHQTATHNGMDAQATVHPTAATIKASTIL
SSKPLIQPRPVCVAALPVPQAPSPAKALILHSLPSRDQSRPVVLSQSVCLGSAPAIVKME
PGSPTMPHCHSPTAPFPSKPIVPASSLPGSNCNGMDVSVCQSHVSQSVSSSLSRSSSTAA
LPRASLSDHTPSSAMINCHAFSPPTGSQMKVMKRQQRMIKNRESACQSRKKKKEYLQNLE
GQLREVQQENERLRKENQALRERLAGKEGSESGNNKRAVCVMAVLLFMTFSLGPVSITDR
KLETDLQEEVVPHTGRHLLEFETAQEHSRVEERIDPEEEGGEDGWKGGEVERESTDSYQF
RNLSDVFSDVKDLVLQDIDRYFTSNDCRQFNRSESLRLADELRGWVHRHQIDRKKSGGKP
KMVKKAKIAQKAQLRKTNISRYLPIQTHRSIDSQIQVFPAGPEISYSDFMDAIDRREDTF
YVVSFRRDHLLLPAISHNKTTRPKMSLVMPAMSVNESLYNKSQGYEMMMQVDCEVMDTRI
IPIKASAVPPSLRDPPPAPPAHHHHSNHTSLRGRHHPHTGGAASPRQPLPARRQEAEYYI
SQGGGV
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgactacggatttactatctgatttggatactcgtttcttcgctgataaccttctgaca
agcgaggattgggatgcctgtctgtaccagtgtgagagcatggaggagggagaggacgga
gagtacacgagaggaccgaaatatgaaacatcgtttgacaacgatctcgtgctgaccctt
gatcccgacaatcccacgtcgccatggagacacctggacgacaaccttctcacagtgttc
cgggtgaaggcggagcctccctcccctgcctcctcgctggcctccgactgctccctgacc
tcactcccagactcacagatcacagtgaaaggagagaacccgcccacgcctccttatatg
tttggagatgtgctgtcgccaccacttggcacatgtgaagtcacggtggcctctgcacaa
ctgtcccggccacagtccaaactgcctcctcagcaacaccaaacagcaacccacaacggc
atggacgcacaggccacagtccaccccactgcggccacgatcaaagccagtaccatcctg
agcagtaagcctctcatccagcccagacctgtgtgtgtagcggctctccccgtcccccag
gctccgagtccagccaaggccctcatactgcacagcctgcctagcagggaccagagcagg
cctgtggtgctttcccagtcagtctgtctggggtccgcgccagccatcgtcaaaatggag
cccggctcccccaccatgcctcactgccatagccccacggccccattccccagcaaaccc
atagtcccggcgtcctctctgccagggagcaactgcaacggcatggatgtgagtgtctgt
cagtcgcatgtcagtcagtcagtgagtagttctctttcacgctcttcttcaaccgccgcc
ttaccccgggcttcactgtcagatcacacacccagttctgccatgattaactgtcatgcg
ttctcccctccgaccgggtctcagatgaaggtgatgaagaggcagcagcggatgatcaag
aaccgggagtcggcgtgccagtcacgcaagaagaagaaggagtacctgcagaacctggag
ggccagctgagggaggtgcagcaggagaacgagcgcctccgcaaggagaaccaggccctg
agggagaggcttgccgggaaagagggcagtgaatctggtaacaacaagagggccgtctgc
gtcatggcagtgctactgttcatgaccttcagtttgggccctgtcagtatcacagacagg
aagctggagacggatttacaggaagaggtggtccctcacacaggaagacatctcctggag
tttgagacggctcaggaacacagcagagtggaggaaaggatagatcctgaggaggaggga
ggagaggatgggtggaagggaggagaggtggagagggaatccaccgattcttaccagttt
aggaacctgagtgacgtgttcagcgacgtgaaggacctggtcctgcaggacatcgaccgc
tatttcacctccaatgactgcaggcagttcaaccgctccgagtccctcaggctggcggat
gagctgagaggatgggtccacaggcaccagatcgacaggaagaagtctggagggaagcca
aagatggtgaaaaaagctaaaatagcacagaaagcgcagcttaggaagacaaacatctcc
agatatcttcccattcagacccatcgttccattgacagtcagatacaagtgttccctgct
ggtccagagatcagctacagtgacttcatggacgccatcgaccggcgtgaggacaccttc
tacgtggtctccttcagacgggatcacctgctgttgccagccatcagccacaacaagacc
acacggcccaaaatgtctctggtgatgccggctatgtctgtcaacgagagtttatataac
aaatcccagggctatgagatgatgatgcaggtggattgtgaggtcatggacacccggatc
atccccatcaaagcctccgctgttcccccgtccctccgcgacccccctcccgctcccccc
gcccaccatcaccacagcaaccacacctccctccgaggccgccaccatccccacaccggc
ggagcggcgtctccacggcaacccttacctgccagaagacaggaggccgagtattacatc
agccaggggggcggggtctga

DBGET integrated database retrieval system