KEGG   Salmo salar (Atlantic salmon): 106589390Help
Entry
106589390         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04115  p53 signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04218  Cellular senescence
sasa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106589390
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106589390
   04070 Phosphatidylinositol signaling system
    106589390
   04150 mTOR signaling pathway
    106589390
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106589390
  09143 Cell growth and death
   04115 p53 signaling pathway
    106589390
   04218 Cellular senescence
    106589390
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106589390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106589390
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106589390
    3.1.3.48  protein-tyrosine-phosphatase
     106589390
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     106589390
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    106589390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 APG12
Motif
Other DBs
NCBI-GeneID: 106589390
NCBI-ProteinID: XP_014034772
UniProt: A0A1S3Q4A5
LinkDB All DBs
Position
ssa28
AA seq 426 aa AA seqDB search
MAAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKHHYKIYNLCAERHYDATKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSENDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQDALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKNQLEYKPVALLFHKMVFETVPMFSGGTCRDTSVKNKSEQIPHGFRKGNWHWDPQFVV
FQLKVKIHTSNPVNTRREEKYVFFELPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPDEKVENGTLPKEQEGIQTTGGTGDNDKECLILSLTKNDLDKANKDKANRYFSPN
FKVSQVKLYFTKTVEDPFNSEASTSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEEQL
TQITKV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcataaaggaaattgtcagccgaaacaaaaggagataccaggaagatggg
tttgacttggacttgacttatatttatccaaacataattgctatgggctttcctgctgaa
agacttgagggtgtctacagaaacaacatcgatgacgtagtacggtttctggactctaaa
cacaaacatcattacaagatatataatctgtgcgctgagcgacattatgacgcaaccaaa
ttcaattgcagagttgcacaatatccgtttgaggatcacaatccgccccagctggagctg
atcaaaccgttctgcgaagatcttgaccagtggttaagtgaaaacgacaatcatgtggcg
gcgattcactgtaaagctggaaagggacgtacgggtgtcatgatctgtgcttacctgtta
caccggggcaagttcctcaaagcacaagatgctctcgacttctacggcgaagtcaggacc
agagataagaagggagtaacaatccccagtcagaggcggtatgtctactactacagccac
cttctgaagaaccagctggagtacaaaccagtggctctgctgttccacaagatggtgttc
gagacggtgcccatgttcagtggtggaacgtgtagggacacttccgttaaaaacaagagt
gagcagattccacatggtttcagaaaagggaattggcactgggatcctcagtttgtggtg
ttccagctcaaggtaaagatccacacgtccaacccggtgaacacgcggcgggaggagaag
tacgtgttcttcgagttgccccagccgctgcccgtgtgtggagacatcaaggtggagttc
ttccacaaacagaacaaaatgatgaaaaaggacaagatgtttcacttctgggtgaacacc
ttcttcatccctggaccagacgagaaggtggagaacgggacgttaccgaaggagcaggaa
ggaatccaaaccacaggaggaacgggagacaacgacaaggaatgcctgatcctctcactg
acgaagaacgacctggataaggccaacaaggataaagcaaacagatacttctcccccaac
ttcaaggtcagtcaggtgaagctgtactttaccaagactgtggaggaccccttcaactct
gaggccagcacttccacctcggtaacgccagacgttagtgacaacgagcctgaccattac
cgatactctgacaccacagactctgacccagagaatgaaccatttgacgaggagcaactc
acacaaataacaaaagtgtga

DBGET integrated database retrieval system